Query 036090
Match_columns 177
No_of_seqs 20 out of 22
Neff 1.8
Searched_HMMs 46136
Date Fri Mar 29 09:21:37 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036090.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036090hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 cd05836 N_Pac_NP60 The PWWP do 62.9 3.7 8E-05 29.5 0.9 39 110-152 9-47 (86)
2 cd05835 Dnmt3b_related The PWW 62.7 3.8 8.2E-05 29.3 1.0 16 110-125 9-24 (87)
3 smart00293 PWWP domain with co 62.5 3.9 8.5E-05 27.4 1.0 16 110-125 9-24 (63)
4 PF00855 PWWP: PWWP domain; I 58.4 5.6 0.00012 26.7 1.1 16 110-125 9-24 (86)
5 cd05840 SPBC215_ISWI_like The 56.9 5.2 0.00011 29.3 0.9 16 110-125 9-24 (93)
6 cd05834 HDGF_related The PWWP 55.7 6.1 0.00013 28.3 1.1 35 110-152 11-45 (83)
7 PF01530 zf-C2HC: Zinc finger, 38.4 12 0.00025 24.0 0.2 13 97-109 7-19 (31)
8 cd05162 PWWP The PWWP domain, 38.1 17 0.00036 25.1 1.0 19 110-128 9-27 (87)
9 cd05841 BS69_related The PWWP 36.4 18 0.0004 26.6 1.0 17 109-125 14-30 (83)
10 COG5041 SKB2 Casein kinase II, 33.0 45 0.00097 29.6 3.0 58 83-155 120-181 (242)
11 PRK13720 modulator of post-seg 32.1 16 0.00034 27.2 0.1 11 101-111 54-64 (70)
12 PRK14282 chaperone protein Dna 31.7 36 0.00077 29.8 2.2 34 96-133 172-205 (369)
13 PF02793 HRM: Hormone receptor 31.6 28 0.00061 23.0 1.2 20 120-139 21-46 (66)
14 cd05837 MSH6_like The PWWP dom 31.1 24 0.00052 26.2 0.9 15 110-124 11-25 (110)
15 PRK00349 uvrA excinuclease ABC 29.2 37 0.0008 34.1 2.1 40 99-147 744-790 (943)
16 PLN03165 chaperone protein dna 27.7 64 0.0014 25.0 2.8 48 78-133 38-85 (111)
17 PRK14300 chaperone protein Dna 24.3 46 0.00099 29.2 1.6 14 95-108 164-177 (372)
18 cd06080 MUM1_like Mutated mela 24.0 39 0.00084 24.7 0.9 16 110-125 9-24 (80)
19 cd05838 WHSC1_related The PWWP 22.6 42 0.00092 24.4 0.9 16 110-125 9-24 (95)
20 COG4063 MtrA Tetrahydromethano 22.4 41 0.00089 29.7 0.9 45 91-145 90-134 (238)
21 TIGR00630 uvra excinuclease AB 21.0 43 0.00093 33.6 0.9 46 84-147 736-788 (924)
22 PRK14292 chaperone protein Dna 20.5 67 0.0014 28.0 1.8 18 96-113 160-177 (371)
23 PRK14290 chaperone protein Dna 20.2 96 0.0021 27.1 2.7 14 96-109 168-181 (365)
No 1
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha. In a variety of cell lines, NP60 has been shown to localize to the nucleus. In addition to the PWWP domain, NP60 also contains an AT-hook and a C-terminal NAD-binding domain. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding proteins, that function as transcription factors regulating a variety of developmental processes.
Probab=62.94 E-value=3.7 Score=29.51 Aligned_cols=39 Identities=28% Similarity=0.491 Sum_probs=23.5
Q ss_pred cccCCCcceeeeeecCCchhhccCceeeeeccccceeeeccCC
Q 036090 110 ATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDEVAFGRGE 152 (177)
Q Consensus 110 aavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmdeV~fGr~~ 152 (177)
|-|.||+|||=++..| |.-+. .-++++...---.||...
T Consensus 9 aK~~g~P~WPa~V~~~-~~~~~---~~~~~~~~~~V~FFG~~~ 47 (86)
T cd05836 9 AKMKGFPPWPGRIVKP-PKDLK---KPRGKAKCFFVFFFGSEN 47 (86)
T ss_pred EeCCCCCCCCEEEech-hhhcc---cccCCCCeEEEEEeCCCC
Confidence 5678999999999987 32111 122333444455677553
No 2
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis. In tumorigenesis, DNA methylation by Dnmt3b is known to play a role in the inactivation of tumor suppressor genes. In addition, a point mutation in the PWWP domain of Dnmt3b has been identified in patients with ICF syndrome (immunodeficiency, centromeric instability, and facial anomalies), a rare autosomal recessive disorder characterized by hypomethylation of classical satellite DNA. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=62.65 E-value=3.8 Score=29.27 Aligned_cols=16 Identities=31% Similarity=0.947 Sum_probs=13.8
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-|.||+|||=+++.+
T Consensus 9 aK~kg~pwWP~~V~~~ 24 (87)
T cd05835 9 GKIKGFPWWPGRVVSI 24 (87)
T ss_pred EecCCCCCCCeEEech
Confidence 4578999999999987
No 3
>smart00293 PWWP domain with conserved PWWP motif. conservation of Pro-Trp-Trp-Pro residues
Probab=62.49 E-value=3.9 Score=27.35 Aligned_cols=16 Identities=44% Similarity=1.144 Sum_probs=13.6
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-+.||.|||=+...+
T Consensus 9 aK~~G~p~WPa~V~~~ 24 (63)
T smart00293 9 AKMKGFPWWPALVVSP 24 (63)
T ss_pred EECCCCCCCCeEEcCc
Confidence 5688999999988876
No 4
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified []. The PWWP domain is named after a conserved Pro-Trp-Trp-Pro motif. It is present in proteins of nuclear origin and plays a role in cell growth and differentiation. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present it has been suggested that the domain is involved in protein-protein interactions [].; PDB: 3LYI_B 2L89_A 2NLU_A 1RI0_A 1KHC_A 3QKJ_C 2DAQ_A 1N27_A 3PFS_B 3QJ6_A ....
Probab=58.42 E-value=5.6 Score=26.67 Aligned_cols=16 Identities=38% Similarity=1.219 Sum_probs=13.5
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-+.|++|||=.+..|
T Consensus 9 aK~~g~pwWPa~V~~~ 24 (86)
T PF00855_consen 9 AKLKGYPWWPARVCDP 24 (86)
T ss_dssp EEETTSEEEEEEEEEC
T ss_pred EEeCCCCCCceEEeec
Confidence 4578999999998877
No 5
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S. pombe hypothetical protein SPBC215, as well as ISWI complex protein 4. The ISWI (imitation switch) proteins are ATPases responsible for chromatin remodeling in eukaryotes, and SPBC215 is proposed to also bind chromatin. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=56.91 E-value=5.2 Score=29.26 Aligned_cols=16 Identities=38% Similarity=0.630 Sum_probs=13.6
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-|.||.|||-.+..|
T Consensus 9 aK~~GyPwWPA~V~~~ 24 (93)
T cd05840 9 AKVKGFPAWPAIVVPE 24 (93)
T ss_pred EeCCCCCCCCEEECCh
Confidence 5678999999999865
No 6
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF. This family of endogenous nuclear-targeted mitogens includes HRP (HDGF-related proteins 1, 2, 3, 4, or HPR1, HPR2, HPR3, HPR4, respectively) and lens epithelium-derived growth factor, LEDGF. Members of the HDGF family have been linked to human diseases, and HDGF is a prognostic factor in several types of cancer. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=55.72 E-value=6.1 Score=28.28 Aligned_cols=35 Identities=29% Similarity=0.571 Sum_probs=24.0
Q ss_pred cccCCCcceeeeeecCCchhhccCceeeeeccccceeeeccCC
Q 036090 110 ATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDEVAFGRGE 152 (177)
Q Consensus 110 aavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmdeV~fGr~~ 152 (177)
|-+.||.|||=++.++=- . .+..+...=..||...
T Consensus 11 aK~kGyp~WPa~I~~~~~-~-------~~~~~~~~V~FfGt~~ 45 (83)
T cd05834 11 AKVKGYPAWPARVDEPED-W-------KPPGKKYPVYFFGTHE 45 (83)
T ss_pred EecCCCCCCCEEEecccc-c-------CCCCCEEEEEEeCCCC
Confidence 567899999999999822 1 3445555556777543
No 7
>PF01530 zf-C2HC: Zinc finger, C2HC type; InterPro: IPR002515 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents the CysCysHisCys (C2HC) type zinc finger domain found in eukaryotes. Proteins containing these domains include: MYST family histone acetyltransferases [, [] Myelin transcription factor Myt1 [] Suppressor of tumourigenicity protein 18 (ST18) [] More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2CS8_A 1PXE_A 2JX1_A 2JYD_A.
Probab=38.45 E-value=12 Score=23.97 Aligned_cols=13 Identities=46% Similarity=1.066 Sum_probs=8.9
Q ss_pred ccCCCccceeccc
Q 036090 97 KGCNGEGTIQGGI 109 (177)
Q Consensus 97 ~GCnG~GRIqGGi 109 (177)
.||||.|-|.|--
T Consensus 7 pGCdg~GHi~G~~ 19 (31)
T PF01530_consen 7 PGCDGSGHITGKY 19 (31)
T ss_dssp TT--SCSTTTSSS
T ss_pred CCCCccccccCCc
Confidence 5999999998843
No 8
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes. The function of the PWWP domain is still not known precisely; however, based on the fact that other regions of PWWP-domain proteins are responsible for nuclear localization and DNA-binding, is likely that the PWWP domain acts as a site for protein-protein binding interactions, influencing chromatin remodeling and thereby regulating transcriptional processes. Some PWWP-domain proteins have been linked to cancer or other diseases; some are known to function as growth factors.
Probab=38.14 E-value=17 Score=25.10 Aligned_cols=19 Identities=32% Similarity=0.866 Sum_probs=15.1
Q ss_pred cccCCCcceeeeeecCCch
Q 036090 110 ATVPGFGWWPIKAYRPCPG 128 (177)
Q Consensus 110 aavPgFgWWPIKAYRPCP~ 128 (177)
|-+.||+|||=.+..|--.
T Consensus 9 aK~~g~pwWPa~V~~~~~~ 27 (87)
T cd05162 9 AKMKGYPWWPALVVDPPKD 27 (87)
T ss_pred EeCCCCCCCCEEEcccccc
Confidence 4567999999999888643
No 9
>cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions. BS69 is a multi-domain protein, containing bromo, PHD, PWWP, and MYND domains. The specific role of the PWWP domain within BS69 is not clearly identified, but BS69 functions in chromatin remodeling, consistent with other PWWP-containing proteins. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=36.37 E-value=18 Score=26.61 Aligned_cols=17 Identities=41% Similarity=0.882 Sum_probs=14.3
Q ss_pred ccccCCCcceeeeeecC
Q 036090 109 IATVPGFGWWPIKAYRP 125 (177)
Q Consensus 109 iaavPgFgWWPIKAYRP 125 (177)
-|=+-||+|||-|+.++
T Consensus 14 wAK~kGyp~WPAkV~~~ 30 (83)
T cd05841 14 WAKLKGFPYWPAKVMRV 30 (83)
T ss_pred EEeCCCCCCCCEEEeec
Confidence 46678999999999875
No 10
>COG5041 SKB2 Casein kinase II, beta subunit [Signal transduction mechanisms / Cell division and chromosome partitioning / Transcription]
Probab=33.00 E-value=45 Score=29.59 Aligned_cols=58 Identities=29% Similarity=0.621 Sum_probs=45.7
Q ss_pred CCCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhh----ccCceeeeeccccceeeeccCCCCC
Q 036090 83 GFRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFL----ASGGRYRRQGQTMDEVAFGRGEKRA 155 (177)
Q Consensus 83 ~~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fv----esGgrY~RqGQsmdeV~fGr~~~~~ 155 (177)
-++.|++= +||+.+-+-=|+.-+||.. +.|.| ||... .+-+|| |++|.-.||+....-
T Consensus 120 efG~CPRv-------~Cn~~~vLPvGLsDi~g~~--~vkLy--CpsC~dlY~p~Ssr~----~~iDGa~fGtSFPh~ 181 (242)
T COG5041 120 EFGACPRV-------YCNGQQVLPVGLSDIPGKS--SVKLY--CPSCEDLYLPKSSRH----QSIDGAFFGTSFPHM 181 (242)
T ss_pred ccCCCCcc-------cccCcceeccccccCCCCc--eeEEe--cCchhhhcCcccccc----cccccchhccCCchH
Confidence 56777764 6999999999999998875 88999 77765 444444 799999999987653
No 11
>PRK13720 modulator of post-segregation killing protein; Provisional
Probab=32.07 E-value=16 Score=27.16 Aligned_cols=11 Identities=36% Similarity=0.299 Sum_probs=8.8
Q ss_pred Cccceeccccc
Q 036090 101 GEGTIQGGIAT 111 (177)
Q Consensus 101 G~GRIqGGiaa 111 (177)
-+||||||-|-
T Consensus 54 ae~riqggyg~ 64 (70)
T PRK13720 54 LQRRIQGGGGF 64 (70)
T ss_pred hhhhcccCCCc
Confidence 37899999874
No 12
>PRK14282 chaperone protein DnaJ; Provisional
Probab=31.67 E-value=36 Score=29.79 Aligned_cols=34 Identities=24% Similarity=0.415 Sum_probs=19.9
Q ss_pred hccCCCccceeccccccCCCcceeeeeecCCchhhccC
Q 036090 96 EKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASG 133 (177)
Q Consensus 96 ~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesG 133 (177)
-..|+|.|++..-.-.-||+ +....+||.+.-.|
T Consensus 172 C~~C~G~G~~~~~~~~~~G~----~~~~~~C~~C~G~G 205 (369)
T PRK14282 172 CPKCHGTGRIREERRSFFGV----FVSERTCERCGGTG 205 (369)
T ss_pred CCCCCCcCEEEEEEEccCcc----eEEEEECCCCCCcc
Confidence 45799999987654443333 22244666665544
No 13
>PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/). The secretin-like GPCRs include secretin [], calcitonin [], parathyroid hormone/parathyroid hormone-related peptides [] and vasoactive intestinal peptide [], all of which activate adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. These receptors contain seven transmembrane regions, in a manner reminiscent of the rhodopsins and other receptors believed to interact with G-proteins (however there is no significant sequence identity between these families, the secretin-like receptors thus bear their own unique '7TM' signature). Their N terminus is probably located on the extracellular side of the membrane and potentially glycosylated. This N-terminal region contains a long conserved region which allow the binding of large peptidic ligand such as glucagon, secretin, VIP and PACAP; this region contains five conserved cysteines residues which could be involved in disulphide bond. The C-terminal region of these receptor is probably cytoplasmic. Every receptor gene in this family is encoded on multiple exons, and several of these genes are alternatively spliced to yield functionally distinct products. This domain is found in the extracellular part of some of the secretin-like (family 2) GPCRs including the calcitonin receptor; corticotropin releasing factor receptor 1; diuretic hormone receptor; glucagon-like peptide 1 receptor; and parathyroid hormone peptide receptor.; GO: 0004930 G-protein coupled receptor activity, 0016020 membrane; PDB: 3EHT_A 3EHU_A 2L27_A 3EHS_A 4DLO_B 2QKH_A 3C5T_A 3C59_A 3IOL_A 3N7R_B ....
Probab=31.64 E-value=28 Score=23.03 Aligned_cols=20 Identities=35% Similarity=0.507 Sum_probs=15.5
Q ss_pred eeeecCCchhhc------cCceeeee
Q 036090 120 IKAYRPCPGFLA------SGGRYRRQ 139 (177)
Q Consensus 120 IKAYRPCP~fve------sGgrY~Rq 139 (177)
..|+.|||.+.. .|-.||+=
T Consensus 21 ~~a~~~CP~~~~~~~~~~~g~a~R~C 46 (66)
T PF02793_consen 21 ETASQPCPSGFYGFGSDTSGNATRNC 46 (66)
T ss_dssp EEEEEECSTTSTCCTSSTTSEEEEEE
T ss_pred CEEEeeCcCCccccccccceeEEEEc
Confidence 468999999986 67777764
No 14
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS. The PWWP domain of histone-lysine N-methyltransferase, also known as Nuclear SET domain-containing protein 3, is also included. Mutations in MSH6 have been linked to increased cancer susceptibility, particularly in hereditary nonpolyposis colorectal cancer in humans. The role of the PWWP domain in MSH6 is not clear; MSH6 orthologs found in S. cerevisiae, Caenorhabditis elegans and Arabidopsis thaliana lack the PWWP domain. Histone methyltransferases (HMTases) induce the posttranslational methylation of lysine residues in histones and play a role in apoptosis. In the HMTase Whistle, the PWWP domain is necessary for HMTase activity. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain pro
Probab=31.11 E-value=24 Score=26.23 Aligned_cols=15 Identities=40% Similarity=1.094 Sum_probs=12.6
Q ss_pred cccCCCcceeeeeec
Q 036090 110 ATVPGFGWWPIKAYR 124 (177)
Q Consensus 110 aavPgFgWWPIKAYR 124 (177)
|-+.||.|||=..+.
T Consensus 11 aK~~g~PwWPa~V~~ 25 (110)
T cd05837 11 AKVSGYPWWPCMVCS 25 (110)
T ss_pred EeCCCCCCCCEEEec
Confidence 567899999998884
No 15
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=29.24 E-value=37 Score=34.13 Aligned_cols=40 Identities=35% Similarity=0.815 Sum_probs=28.8
Q ss_pred CCCccceeccccccCCCcceeeeeecCCchhhccCceeee-------eccccceee
Q 036090 99 CNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRR-------QGQTMDEVA 147 (177)
Q Consensus 99 CnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~R-------qGQsmdeV~ 147 (177)
|.|+|.|.--|+..|. .|.|||.+ .|.||+. +|.+..||+
T Consensus 744 C~G~G~~~~~~~f~~~-------~~~~C~~C--~G~R~~~e~l~v~~~g~~i~dvl 790 (943)
T PRK00349 744 CQGDGVIKIEMHFLPD-------VYVPCDVC--KGKRYNRETLEVKYKGKNIADVL 790 (943)
T ss_pred ccccceEEEEeccCCC-------ccccCccc--cCccccccceEEEECCCCHHHHh
Confidence 4489999988888764 68999986 3555554 466666664
No 16
>PLN03165 chaperone protein dnaJ-related; Provisional
Probab=27.74 E-value=64 Score=25.00 Aligned_cols=48 Identities=19% Similarity=0.307 Sum_probs=31.7
Q ss_pred cCCCCCCCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccC
Q 036090 78 GADKVGFRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASG 133 (177)
Q Consensus 78 ~~~d~~~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesG 133 (177)
......+..|.+.|.. .-.-|+|.|+|.-=.+ ++ ...+.+||...-.|
T Consensus 38 ~~~~v~C~~C~GsG~~-~C~~C~G~G~v~~~~~-----g~--~q~~~~C~~C~G~G 85 (111)
T PLN03165 38 RENTQPCFPCSGTGAQ-VCRFCVGSGNVTVELG-----GG--EKEVSKCINCDGAG 85 (111)
T ss_pred hccCCCCCCCCCCCCc-CCCCCcCcCeEEEEeC-----Cc--EEEEEECCCCCCcc
Confidence 3444556677776763 5668999999873211 11 45688999998877
No 17
>PRK14300 chaperone protein DnaJ; Provisional
Probab=24.26 E-value=46 Score=29.24 Aligned_cols=14 Identities=21% Similarity=0.415 Sum_probs=10.6
Q ss_pred hhccCCCccceecc
Q 036090 95 LEKGCNGEGTIQGG 108 (177)
Q Consensus 95 ~~~GCnG~GRIqGG 108 (177)
.-..|+|.|++.-.
T Consensus 164 ~C~~C~G~G~~~~~ 177 (372)
T PRK14300 164 TCDACSGVGATRMQ 177 (372)
T ss_pred cCCCccCeEEEEEe
Confidence 35689999998753
No 18
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA). MUM-1 belongs to the mutated or aberrantly expressed type of MAAs, along with antigens such as CDK4, beta-catenin, gp100-in4, p15, and N-acetylglucosaminyltransferase V. It is highly expressed in several types of human cancers. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=24.04 E-value=39 Score=24.71 Aligned_cols=16 Identities=31% Similarity=0.902 Sum_probs=12.5
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-+-||+|||=++..+
T Consensus 9 aK~~g~P~WPa~I~~~ 24 (80)
T cd06080 9 AKIQGYPWWPAVIKSI 24 (80)
T ss_pred EeCCCCCCCCEEEeee
Confidence 4578999999887654
No 19
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS). When translocated, WHSC1 plays a role in lymphoid multiple myeloma (MM) disease, also known as plasmacytoma. WHCS1 proteins typically contain two copies of the PWWP domain. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=22.59 E-value=42 Score=24.40 Aligned_cols=16 Identities=38% Similarity=1.003 Sum_probs=13.0
Q ss_pred cccCCCcceeeeeecC
Q 036090 110 ATVPGFGWWPIKAYRP 125 (177)
Q Consensus 110 aavPgFgWWPIKAYRP 125 (177)
|-+.|+.|||-..+-|
T Consensus 9 aK~~g~pwWPa~V~~~ 24 (95)
T cd05838 9 AKLGNFRWWPAIICDP 24 (95)
T ss_pred EECCCCCCCCeEEcCh
Confidence 4578899999998865
No 20
>COG4063 MtrA Tetrahydromethanopterin S-methyltransferase, subunit A [Coenzyme metabolism]
Probab=22.37 E-value=41 Score=29.68 Aligned_cols=45 Identities=22% Similarity=0.301 Sum_probs=31.0
Q ss_pred chhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccCceeeeeccccce
Q 036090 91 GKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDE 145 (177)
Q Consensus 91 G~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmde 145 (177)
=++-.+.|-+.+|||+|-.||+|-+-=-|= |+=-|||||=.-+|-
T Consensus 90 ~~alh~NGvdd~g~IiGa~GAIPyiENi~~----------eaveRfqqqvelvdl 134 (238)
T COG4063 90 MKALHANGVDDKGRIIGATGAIPYIENIPD----------EAVERFQQQVELVDL 134 (238)
T ss_pred HHHHHhcCCCccCcEecccccchhhhcCCH----------HHHHHHHHHeeeehh
Confidence 345668899999999999999986543332 333577766555543
No 21
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.02 E-value=43 Score=33.60 Aligned_cols=46 Identities=33% Similarity=0.735 Sum_probs=32.9
Q ss_pred CCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccCceeee-------eccccceee
Q 036090 84 FRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRR-------QGQTMDEVA 147 (177)
Q Consensus 84 ~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~R-------qGQsmdeV~ 147 (177)
.+.|+.| .|.|.|.--|+.+|- +|.|||.+- |-||+. +|.++.||+
T Consensus 736 ~G~C~~C---------~G~G~~~~~~~f~~~-------~~~~C~~C~--G~R~~~e~l~v~~~g~~i~dvl 788 (924)
T TIGR00630 736 GGRCEAC---------QGDGVIKIEMHFLPD-------VYVPCEVCK--GKRYNRETLEVKYKGKNIADVL 788 (924)
T ss_pred CCCCCCC---------ccceEEEEEccCCCC-------cccCCCCcC--CceeChHHHhceeCCCCHHHHh
Confidence 3567765 489999999998876 489999873 555543 466666654
No 22
>PRK14292 chaperone protein DnaJ; Provisional
Probab=20.46 E-value=67 Score=28.00 Aligned_cols=18 Identities=22% Similarity=0.471 Sum_probs=11.6
Q ss_pred hccCCCccceeccccccC
Q 036090 96 EKGCNGEGTIQGGIATVP 113 (177)
Q Consensus 96 ~~GCnG~GRIqGGiaavP 113 (177)
-..|+|.|++..=+=.++
T Consensus 160 C~~C~G~G~~~~~~~~~~ 177 (371)
T PRK14292 160 CPTCRGAGAVRAQARTIF 177 (371)
T ss_pred CCCCCCccEEEEEEeccC
Confidence 457889998875443333
No 23
>PRK14290 chaperone protein DnaJ; Provisional
Probab=20.21 E-value=96 Score=27.11 Aligned_cols=14 Identities=21% Similarity=0.252 Sum_probs=10.0
Q ss_pred hccCCCccceeccc
Q 036090 96 EKGCNGEGTIQGGI 109 (177)
Q Consensus 96 ~~GCnG~GRIqGGi 109 (177)
-..|+|.|+++--.
T Consensus 168 C~~C~G~G~~~~~~ 181 (365)
T PRK14290 168 CPTCHGTGQQRIVR 181 (365)
T ss_pred CCCCCCcCEEEEEe
Confidence 45789999876544
Done!