Query         036090
Match_columns 177
No_of_seqs    20 out of 22
Neff          1.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:21:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036090.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036090hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05836 N_Pac_NP60 The PWWP do  62.9     3.7   8E-05   29.5   0.9   39  110-152     9-47  (86)
  2 cd05835 Dnmt3b_related The PWW  62.7     3.8 8.2E-05   29.3   1.0   16  110-125     9-24  (87)
  3 smart00293 PWWP domain with co  62.5     3.9 8.5E-05   27.4   1.0   16  110-125     9-24  (63)
  4 PF00855 PWWP:  PWWP domain;  I  58.4     5.6 0.00012   26.7   1.1   16  110-125     9-24  (86)
  5 cd05840 SPBC215_ISWI_like The   56.9     5.2 0.00011   29.3   0.9   16  110-125     9-24  (93)
  6 cd05834 HDGF_related The PWWP   55.7     6.1 0.00013   28.3   1.1   35  110-152    11-45  (83)
  7 PF01530 zf-C2HC:  Zinc finger,  38.4      12 0.00025   24.0   0.2   13   97-109     7-19  (31)
  8 cd05162 PWWP The PWWP domain,   38.1      17 0.00036   25.1   1.0   19  110-128     9-27  (87)
  9 cd05841 BS69_related The PWWP   36.4      18  0.0004   26.6   1.0   17  109-125    14-30  (83)
 10 COG5041 SKB2 Casein kinase II,  33.0      45 0.00097   29.6   3.0   58   83-155   120-181 (242)
 11 PRK13720 modulator of post-seg  32.1      16 0.00034   27.2   0.1   11  101-111    54-64  (70)
 12 PRK14282 chaperone protein Dna  31.7      36 0.00077   29.8   2.2   34   96-133   172-205 (369)
 13 PF02793 HRM:  Hormone receptor  31.6      28 0.00061   23.0   1.2   20  120-139    21-46  (66)
 14 cd05837 MSH6_like The PWWP dom  31.1      24 0.00052   26.2   0.9   15  110-124    11-25  (110)
 15 PRK00349 uvrA excinuclease ABC  29.2      37  0.0008   34.1   2.1   40   99-147   744-790 (943)
 16 PLN03165 chaperone protein dna  27.7      64  0.0014   25.0   2.8   48   78-133    38-85  (111)
 17 PRK14300 chaperone protein Dna  24.3      46 0.00099   29.2   1.6   14   95-108   164-177 (372)
 18 cd06080 MUM1_like Mutated mela  24.0      39 0.00084   24.7   0.9   16  110-125     9-24  (80)
 19 cd05838 WHSC1_related The PWWP  22.6      42 0.00092   24.4   0.9   16  110-125     9-24  (95)
 20 COG4063 MtrA Tetrahydromethano  22.4      41 0.00089   29.7   0.9   45   91-145    90-134 (238)
 21 TIGR00630 uvra excinuclease AB  21.0      43 0.00093   33.6   0.9   46   84-147   736-788 (924)
 22 PRK14292 chaperone protein Dna  20.5      67  0.0014   28.0   1.8   18   96-113   160-177 (371)
 23 PRK14290 chaperone protein Dna  20.2      96  0.0021   27.1   2.7   14   96-109   168-181 (365)

No 1  
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha.  In a variety of cell lines, NP60 has been shown to localize to the nucleus. In addition to the PWWP domain, NP60 also contains an AT-hook and a C-terminal NAD-binding domain. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding proteins, that function as transcription factors regulating a variety of developmental processes.
Probab=62.94  E-value=3.7  Score=29.51  Aligned_cols=39  Identities=28%  Similarity=0.491  Sum_probs=23.5

Q ss_pred             cccCCCcceeeeeecCCchhhccCceeeeeccccceeeeccCC
Q 036090          110 ATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDEVAFGRGE  152 (177)
Q Consensus       110 aavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmdeV~fGr~~  152 (177)
                      |-|.||+|||=++..| |.-+.   .-++++...---.||...
T Consensus         9 aK~~g~P~WPa~V~~~-~~~~~---~~~~~~~~~~V~FFG~~~   47 (86)
T cd05836           9 AKMKGFPPWPGRIVKP-PKDLK---KPRGKAKCFFVFFFGSEN   47 (86)
T ss_pred             EeCCCCCCCCEEEech-hhhcc---cccCCCCeEEEEEeCCCC
Confidence            5678999999999987 32111   122333444455677553


No 2  
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis.  In tumorigenesis, DNA methylation by Dnmt3b is known to play a role in the inactivation of tumor suppressor genes.  In addition, a point mutation in the PWWP domain of Dnmt3b has been identified in patients with ICF syndrome (immunodeficiency, centromeric instability, and facial anomalies), a rare autosomal recessive disorder characterized by hypomethylation of classical satellite DNA. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=62.65  E-value=3.8  Score=29.27  Aligned_cols=16  Identities=31%  Similarity=0.947  Sum_probs=13.8

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-|.||+|||=+++.+
T Consensus         9 aK~kg~pwWP~~V~~~   24 (87)
T cd05835           9 GKIKGFPWWPGRVVSI   24 (87)
T ss_pred             EecCCCCCCCeEEech
Confidence            4578999999999987


No 3  
>smart00293 PWWP domain with conserved PWWP motif. conservation of Pro-Trp-Trp-Pro residues
Probab=62.49  E-value=3.9  Score=27.35  Aligned_cols=16  Identities=44%  Similarity=1.144  Sum_probs=13.6

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-+.||.|||=+...+
T Consensus         9 aK~~G~p~WPa~V~~~   24 (63)
T smart00293        9 AKMKGFPWWPALVVSP   24 (63)
T ss_pred             EECCCCCCCCeEEcCc
Confidence            5688999999988876


No 4  
>PF00855 PWWP:  PWWP domain;  InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified []. The PWWP domain is named after a conserved Pro-Trp-Trp-Pro motif. It is present in proteins of nuclear origin and plays a role in cell growth and differentiation. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present it has been suggested that the domain is involved in protein-protein interactions [].; PDB: 3LYI_B 2L89_A 2NLU_A 1RI0_A 1KHC_A 3QKJ_C 2DAQ_A 1N27_A 3PFS_B 3QJ6_A ....
Probab=58.42  E-value=5.6  Score=26.67  Aligned_cols=16  Identities=38%  Similarity=1.219  Sum_probs=13.5

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-+.|++|||=.+..|
T Consensus         9 aK~~g~pwWPa~V~~~   24 (86)
T PF00855_consen    9 AKLKGYPWWPARVCDP   24 (86)
T ss_dssp             EEETTSEEEEEEEEEC
T ss_pred             EEeCCCCCCceEEeec
Confidence            4578999999998877


No 5  
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S. pombe hypothetical protein SPBC215, as well as ISWI complex protein 4.  The ISWI (imitation switch) proteins are ATPases responsible for chromatin remodeling in eukaryotes, and SPBC215 is proposed to also bind chromatin.   The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding,  proteins that function as transcription factors regulating a variety of developmental processes.
Probab=56.91  E-value=5.2  Score=29.26  Aligned_cols=16  Identities=38%  Similarity=0.630  Sum_probs=13.6

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-|.||.|||-.+..|
T Consensus         9 aK~~GyPwWPA~V~~~   24 (93)
T cd05840           9 AKVKGFPAWPAIVVPE   24 (93)
T ss_pred             EeCCCCCCCCEEECCh
Confidence            5678999999999865


No 6  
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF. This family of endogenous nuclear-targeted mitogens includes HRP (HDGF-related proteins 1, 2, 3, 4, or HPR1, HPR2, HPR3, HPR4, respectively) and lens epithelium-derived growth factor, LEDGF. Members of the HDGF family have been linked to human diseases, and HDGF is a prognostic factor in several types of cancer. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=55.72  E-value=6.1  Score=28.28  Aligned_cols=35  Identities=29%  Similarity=0.571  Sum_probs=24.0

Q ss_pred             cccCCCcceeeeeecCCchhhccCceeeeeccccceeeeccCC
Q 036090          110 ATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDEVAFGRGE  152 (177)
Q Consensus       110 aavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmdeV~fGr~~  152 (177)
                      |-+.||.|||=++.++=- .       .+..+...=..||...
T Consensus        11 aK~kGyp~WPa~I~~~~~-~-------~~~~~~~~V~FfGt~~   45 (83)
T cd05834          11 AKVKGYPAWPARVDEPED-W-------KPPGKKYPVYFFGTHE   45 (83)
T ss_pred             EecCCCCCCCEEEecccc-c-------CCCCCEEEEEEeCCCC
Confidence            567899999999999822 1       3445555556777543


No 7  
>PF01530 zf-C2HC:  Zinc finger, C2HC type;  InterPro: IPR002515 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (C2HC) type zinc finger domain found in eukaryotes. Proteins containing these domains include:   MYST family histone acetyltransferases [, [] Myelin transcription factor Myt1 [] Suppressor of tumourigenicity protein 18 (ST18) []   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2CS8_A 1PXE_A 2JX1_A 2JYD_A.
Probab=38.45  E-value=12  Score=23.97  Aligned_cols=13  Identities=46%  Similarity=1.066  Sum_probs=8.9

Q ss_pred             ccCCCccceeccc
Q 036090           97 KGCNGEGTIQGGI  109 (177)
Q Consensus        97 ~GCnG~GRIqGGi  109 (177)
                      .||||.|-|.|--
T Consensus         7 pGCdg~GHi~G~~   19 (31)
T PF01530_consen    7 PGCDGSGHITGKY   19 (31)
T ss_dssp             TT--SCSTTTSSS
T ss_pred             CCCCccccccCCc
Confidence            5999999998843


No 8  
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids.  The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation.  Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.  The function of the PWWP domain is still not known precisely; however, based on the fact that other regions of PWWP-domain proteins are responsible for nuclear localization and DNA-binding, is likely that the PWWP domain acts as a site for protein-protein binding interactions, influencing chromatin remodeling and thereby regulating transcriptional processes.  Some PWWP-domain proteins have been linked to cancer or other diseases; some are known to function as growth factors.
Probab=38.14  E-value=17  Score=25.10  Aligned_cols=19  Identities=32%  Similarity=0.866  Sum_probs=15.1

Q ss_pred             cccCCCcceeeeeecCCch
Q 036090          110 ATVPGFGWWPIKAYRPCPG  128 (177)
Q Consensus       110 aavPgFgWWPIKAYRPCP~  128 (177)
                      |-+.||+|||=.+..|--.
T Consensus         9 aK~~g~pwWPa~V~~~~~~   27 (87)
T cd05162           9 AKMKGYPWWPALVVDPPKD   27 (87)
T ss_pred             EeCCCCCCCCEEEcccccc
Confidence            4567999999999888643


No 9  
>cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions.  BS69 is a multi-domain protein, containing bromo, PHD, PWWP, and MYND domains.  The specific role of the PWWP domain within BS69 is not clearly identified, but BS69 functions in chromatin remodeling, consistent with other PWWP-containing proteins. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=36.37  E-value=18  Score=26.61  Aligned_cols=17  Identities=41%  Similarity=0.882  Sum_probs=14.3

Q ss_pred             ccccCCCcceeeeeecC
Q 036090          109 IATVPGFGWWPIKAYRP  125 (177)
Q Consensus       109 iaavPgFgWWPIKAYRP  125 (177)
                      -|=+-||+|||-|+.++
T Consensus        14 wAK~kGyp~WPAkV~~~   30 (83)
T cd05841          14 WAKLKGFPYWPAKVMRV   30 (83)
T ss_pred             EEeCCCCCCCCEEEeec
Confidence            46678999999999875


No 10 
>COG5041 SKB2 Casein kinase II, beta subunit [Signal transduction mechanisms / Cell division and chromosome partitioning / Transcription]
Probab=33.00  E-value=45  Score=29.59  Aligned_cols=58  Identities=29%  Similarity=0.621  Sum_probs=45.7

Q ss_pred             CCCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhh----ccCceeeeeccccceeeeccCCCCC
Q 036090           83 GFRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFL----ASGGRYRRQGQTMDEVAFGRGEKRA  155 (177)
Q Consensus        83 ~~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fv----esGgrY~RqGQsmdeV~fGr~~~~~  155 (177)
                      -++.|++=       +||+.+-+-=|+.-+||..  +.|.|  ||...    .+-+||    |++|.-.||+....-
T Consensus       120 efG~CPRv-------~Cn~~~vLPvGLsDi~g~~--~vkLy--CpsC~dlY~p~Ssr~----~~iDGa~fGtSFPh~  181 (242)
T COG5041         120 EFGACPRV-------YCNGQQVLPVGLSDIPGKS--SVKLY--CPSCEDLYLPKSSRH----QSIDGAFFGTSFPHM  181 (242)
T ss_pred             ccCCCCcc-------cccCcceeccccccCCCCc--eeEEe--cCchhhhcCcccccc----cccccchhccCCchH
Confidence            56777764       6999999999999998875  88999  77765    444444    799999999987653


No 11 
>PRK13720 modulator of post-segregation killing protein; Provisional
Probab=32.07  E-value=16  Score=27.16  Aligned_cols=11  Identities=36%  Similarity=0.299  Sum_probs=8.8

Q ss_pred             Cccceeccccc
Q 036090          101 GEGTIQGGIAT  111 (177)
Q Consensus       101 G~GRIqGGiaa  111 (177)
                      -+||||||-|-
T Consensus        54 ae~riqggyg~   64 (70)
T PRK13720         54 LQRRIQGGGGF   64 (70)
T ss_pred             hhhhcccCCCc
Confidence            37899999874


No 12 
>PRK14282 chaperone protein DnaJ; Provisional
Probab=31.67  E-value=36  Score=29.79  Aligned_cols=34  Identities=24%  Similarity=0.415  Sum_probs=19.9

Q ss_pred             hccCCCccceeccccccCCCcceeeeeecCCchhhccC
Q 036090           96 EKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASG  133 (177)
Q Consensus        96 ~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesG  133 (177)
                      -..|+|.|++..-.-.-||+    +....+||.+.-.|
T Consensus       172 C~~C~G~G~~~~~~~~~~G~----~~~~~~C~~C~G~G  205 (369)
T PRK14282        172 CPKCHGTGRIREERRSFFGV----FVSERTCERCGGTG  205 (369)
T ss_pred             CCCCCCcCEEEEEEEccCcc----eEEEEECCCCCCcc
Confidence            45799999987654443333    22244666665544


No 13 
>PF02793 HRM:  Hormone receptor domain;  InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The secretin-like GPCRs include secretin [], calcitonin [], parathyroid hormone/parathyroid hormone-related peptides [] and vasoactive intestinal peptide [], all of which activate adenylyl cyclase and the phosphatidyl-inositol-calcium pathway. These receptors contain seven transmembrane regions, in a manner reminiscent of the rhodopsins and other receptors believed to interact with G-proteins (however there is no significant sequence identity between these families, the secretin-like receptors thus bear their own unique '7TM' signature). Their N terminus is probably located on the extracellular side of the membrane and potentially glycosylated. This N-terminal region contains a long conserved region which allow the binding of large peptidic ligand such as glucagon, secretin, VIP and PACAP; this region contains five conserved cysteines residues which could be involved in disulphide bond. The C-terminal region of these receptor is probably cytoplasmic. Every receptor gene in this family is encoded on multiple exons, and several of these genes are alternatively spliced to yield functionally distinct products.  This domain is found in the extracellular part of some of the secretin-like (family 2) GPCRs including the calcitonin receptor; corticotropin releasing factor receptor 1; diuretic hormone receptor; glucagon-like peptide 1 receptor; and parathyroid hormone peptide receptor.; GO: 0004930 G-protein coupled receptor activity, 0016020 membrane; PDB: 3EHT_A 3EHU_A 2L27_A 3EHS_A 4DLO_B 2QKH_A 3C5T_A 3C59_A 3IOL_A 3N7R_B ....
Probab=31.64  E-value=28  Score=23.03  Aligned_cols=20  Identities=35%  Similarity=0.507  Sum_probs=15.5

Q ss_pred             eeeecCCchhhc------cCceeeee
Q 036090          120 IKAYRPCPGFLA------SGGRYRRQ  139 (177)
Q Consensus       120 IKAYRPCP~fve------sGgrY~Rq  139 (177)
                      ..|+.|||.+..      .|-.||+=
T Consensus        21 ~~a~~~CP~~~~~~~~~~~g~a~R~C   46 (66)
T PF02793_consen   21 ETASQPCPSGFYGFGSDTSGNATRNC   46 (66)
T ss_dssp             EEEEEECSTTSTCCTSSTTSEEEEEE
T ss_pred             CEEEeeCcCCccccccccceeEEEEc
Confidence            468999999986      67777764


No 14 
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS.   The PWWP domain of histone-lysine N-methyltransferase, also known as Nuclear SET domain-containing protein 3, is also included. Mutations in MSH6 have been linked to increased cancer susceptibility, particularly in hereditary nonpolyposis colorectal cancer in humans.  The role of the PWWP domain in MSH6 is not clear; MSH6 orthologs found in S. cerevisiae, Caenorhabditis elegans and Arabidopsis thaliana lack the PWWP domain.   Histone methyltransferases (HMTases) induce the posttranslational methylation of lysine residues in histones and play a role in apoptosis.  In the HMTase Whistle, the PWWP domain is necessary for HMTase activity. The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain pro
Probab=31.11  E-value=24  Score=26.23  Aligned_cols=15  Identities=40%  Similarity=1.094  Sum_probs=12.6

Q ss_pred             cccCCCcceeeeeec
Q 036090          110 ATVPGFGWWPIKAYR  124 (177)
Q Consensus       110 aavPgFgWWPIKAYR  124 (177)
                      |-+.||.|||=..+.
T Consensus        11 aK~~g~PwWPa~V~~   25 (110)
T cd05837          11 AKVSGYPWWPCMVCS   25 (110)
T ss_pred             EeCCCCCCCCEEEec
Confidence            567899999998884


No 15 
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=29.24  E-value=37  Score=34.13  Aligned_cols=40  Identities=35%  Similarity=0.815  Sum_probs=28.8

Q ss_pred             CCCccceeccccccCCCcceeeeeecCCchhhccCceeee-------eccccceee
Q 036090           99 CNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRR-------QGQTMDEVA  147 (177)
Q Consensus        99 CnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~R-------qGQsmdeV~  147 (177)
                      |.|+|.|.--|+..|.       .|.|||.+  .|.||+.       +|.+..||+
T Consensus       744 C~G~G~~~~~~~f~~~-------~~~~C~~C--~G~R~~~e~l~v~~~g~~i~dvl  790 (943)
T PRK00349        744 CQGDGVIKIEMHFLPD-------VYVPCDVC--KGKRYNRETLEVKYKGKNIADVL  790 (943)
T ss_pred             ccccceEEEEeccCCC-------ccccCccc--cCccccccceEEEECCCCHHHHh
Confidence            4489999988888764       68999986  3555554       466666664


No 16 
>PLN03165 chaperone protein dnaJ-related; Provisional
Probab=27.74  E-value=64  Score=25.00  Aligned_cols=48  Identities=19%  Similarity=0.307  Sum_probs=31.7

Q ss_pred             cCCCCCCCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccC
Q 036090           78 GADKVGFRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASG  133 (177)
Q Consensus        78 ~~~d~~~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesG  133 (177)
                      ......+..|.+.|.. .-.-|+|.|+|.-=.+     ++  ...+.+||...-.|
T Consensus        38 ~~~~v~C~~C~GsG~~-~C~~C~G~G~v~~~~~-----g~--~q~~~~C~~C~G~G   85 (111)
T PLN03165         38 RENTQPCFPCSGTGAQ-VCRFCVGSGNVTVELG-----GG--EKEVSKCINCDGAG   85 (111)
T ss_pred             hccCCCCCCCCCCCCc-CCCCCcCcCeEEEEeC-----Cc--EEEEEECCCCCCcc
Confidence            3444556677776763 5668999999873211     11  45688999998877


No 17 
>PRK14300 chaperone protein DnaJ; Provisional
Probab=24.26  E-value=46  Score=29.24  Aligned_cols=14  Identities=21%  Similarity=0.415  Sum_probs=10.6

Q ss_pred             hhccCCCccceecc
Q 036090           95 LEKGCNGEGTIQGG  108 (177)
Q Consensus        95 ~~~GCnG~GRIqGG  108 (177)
                      .-..|+|.|++.-.
T Consensus       164 ~C~~C~G~G~~~~~  177 (372)
T PRK14300        164 TCDACSGVGATRMQ  177 (372)
T ss_pred             cCCCccCeEEEEEe
Confidence            35689999998753


No 18 
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA).  MUM-1 belongs to the mutated or aberrantly expressed type of MAAs, along with antigens such as CDK4, beta-catenin, gp100-in4, p15, and N-acetylglucosaminyltransferase V.  It is highly expressed in several types of human cancers.  The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=24.04  E-value=39  Score=24.71  Aligned_cols=16  Identities=31%  Similarity=0.902  Sum_probs=12.5

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-+-||+|||=++..+
T Consensus         9 aK~~g~P~WPa~I~~~   24 (80)
T cd06080           9 AKIQGYPWWPAVIKSI   24 (80)
T ss_pred             EeCCCCCCCCEEEeee
Confidence            4578999999887654


No 19 
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS).  When translocated, WHSC1 plays a role in lymphoid multiple myeloma (MM) disease, also known as plasmacytoma. WHCS1 proteins typically contain two copies of the PWWP domain.  The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=22.59  E-value=42  Score=24.40  Aligned_cols=16  Identities=38%  Similarity=1.003  Sum_probs=13.0

Q ss_pred             cccCCCcceeeeeecC
Q 036090          110 ATVPGFGWWPIKAYRP  125 (177)
Q Consensus       110 aavPgFgWWPIKAYRP  125 (177)
                      |-+.|+.|||-..+-|
T Consensus         9 aK~~g~pwWPa~V~~~   24 (95)
T cd05838           9 AKLGNFRWWPAIICDP   24 (95)
T ss_pred             EECCCCCCCCeEEcCh
Confidence            4578899999998865


No 20 
>COG4063 MtrA Tetrahydromethanopterin S-methyltransferase, subunit A [Coenzyme metabolism]
Probab=22.37  E-value=41  Score=29.68  Aligned_cols=45  Identities=22%  Similarity=0.301  Sum_probs=31.0

Q ss_pred             chhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccCceeeeeccccce
Q 036090           91 GKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRRQGQTMDE  145 (177)
Q Consensus        91 G~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~RqGQsmde  145 (177)
                      =++-.+.|-+.+|||+|-.||+|-+-=-|=          |+=-|||||=.-+|-
T Consensus        90 ~~alh~NGvdd~g~IiGa~GAIPyiENi~~----------eaveRfqqqvelvdl  134 (238)
T COG4063          90 MKALHANGVDDKGRIIGATGAIPYIENIPD----------EAVERFQQQVELVDL  134 (238)
T ss_pred             HHHHHhcCCCccCcEecccccchhhhcCCH----------HHHHHHHHHeeeehh
Confidence            345668899999999999999986543332          333577766555543


No 21 
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.02  E-value=43  Score=33.60  Aligned_cols=46  Identities=33%  Similarity=0.735  Sum_probs=32.9

Q ss_pred             CCCCCCCchhhhhccCCCccceeccccccCCCcceeeeeecCCchhhccCceeee-------eccccceee
Q 036090           84 FRGCKVCGKEELEKGCNGEGTIQGGIATVPGFGWWPIKAYRPCPGFLASGGRYRR-------QGQTMDEVA  147 (177)
Q Consensus        84 ~~gC~~CG~ee~~~GCnG~GRIqGGiaavPgFgWWPIKAYRPCP~fvesGgrY~R-------qGQsmdeV~  147 (177)
                      .+.|+.|         .|.|.|.--|+.+|-       +|.|||.+-  |-||+.       +|.++.||+
T Consensus       736 ~G~C~~C---------~G~G~~~~~~~f~~~-------~~~~C~~C~--G~R~~~e~l~v~~~g~~i~dvl  788 (924)
T TIGR00630       736 GGRCEAC---------QGDGVIKIEMHFLPD-------VYVPCEVCK--GKRYNRETLEVKYKGKNIADVL  788 (924)
T ss_pred             CCCCCCC---------ccceEEEEEccCCCC-------cccCCCCcC--CceeChHHHhceeCCCCHHHHh
Confidence            3567765         489999999998876       489999873  555543       466666654


No 22 
>PRK14292 chaperone protein DnaJ; Provisional
Probab=20.46  E-value=67  Score=28.00  Aligned_cols=18  Identities=22%  Similarity=0.471  Sum_probs=11.6

Q ss_pred             hccCCCccceeccccccC
Q 036090           96 EKGCNGEGTIQGGIATVP  113 (177)
Q Consensus        96 ~~GCnG~GRIqGGiaavP  113 (177)
                      -..|+|.|++..=+=.++
T Consensus       160 C~~C~G~G~~~~~~~~~~  177 (371)
T PRK14292        160 CPTCRGAGAVRAQARTIF  177 (371)
T ss_pred             CCCCCCccEEEEEEeccC
Confidence            457889998875443333


No 23 
>PRK14290 chaperone protein DnaJ; Provisional
Probab=20.21  E-value=96  Score=27.11  Aligned_cols=14  Identities=21%  Similarity=0.252  Sum_probs=10.0

Q ss_pred             hccCCCccceeccc
Q 036090           96 EKGCNGEGTIQGGI  109 (177)
Q Consensus        96 ~~GCnG~GRIqGGi  109 (177)
                      -..|+|.|+++--.
T Consensus       168 C~~C~G~G~~~~~~  181 (365)
T PRK14290        168 CPTCHGTGQQRIVR  181 (365)
T ss_pred             CCCCCCcCEEEEEe
Confidence            45789999876544


Done!