Citrus Sinensis ID: 036113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MSVNSSAPLSGPVAVEVKVGEKQKNWSTTPSHIVHHFGTSGLAVAVASAVTHPLDVLKVRLQMQFVGQKGPLNGMGRLFLQILKKEGPKSLYLGLTPALTRSILYGGLRLGLYEPSKYACDWAFGSTNILVKIASGAFAGATATALTNPTEVLKVRLQMNSSMKQSGSIAEMRRLISEEGIRALWKGVGPAMARAAALTASQLATYDESKRILIRWTPLEEGFHLHLISSAVAGTMSTLITAPVDMVKTRLMLQRESRKVGSYKNGFHCAYQVVCTEGPRALYKGRGFAVFARLGPQSTITFILCEKLRELAGLNAI
ccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHcccHHHHHHHHHHcccHHEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHcHHHHccccHHHHHHHHHHcccHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccccHHHccHHHHHHHHHHHHHHHHHccccc
*************************WSTTPSHIVHHFGTSGLAVAVASAVTHPLDVLKVRLQMQFVGQKGPLNGMGRLFLQILKKEGPKSLYLGLTPALTRSILYGGLRLGLYEPSKYACDWAFGSTNILVKIASGAFAGATATALTNPTEVLKVRLQMNSSMKQSGSIAEMRRLISEEGIRALWKGVGPAMARAAALTASQLATYDESKRILIRWTPLEEGFHLHLISSAVAGTMSTLITAPVDMVKTRLMLQRESRKVGSYKNGFHCAYQVVCTEGPRALYKGRGFAVFARLGPQSTITFILCEKLRELAGLNAI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVNSSAPLSGPVAVEVKVGEKQKNWSTTPSHIVHHFGTSGLAVAVASAVTHPLDVLKVRLQMQFVGQKGPLNGMGRLFLQILKKEGPKSLYLGLTPALTRSILYGGLRLGLYEPSKYACDWAFGSTNILVKIASGAFAGATATALTNPTEVLKVRLQMNSSMKQSGSIAEMRRLISEEGIRALWKGVGPAMARAAALTASQLATYDESKRILIRWTPLEEGFHLHLISSAVAGTMSTLITAPVDMVKTRLMLQRESRKVGSYKNGFHCAYQVVCTEGPRALYKGRGFAVFARLGPQSTITFILCEKLRELAGLNAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial uncoupling protein 2 UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.probableQ5R5A8
Mitochondrial uncoupling protein 2 UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.probableP56500
Mitochondrial uncoupling protein 2 UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.probableO97562

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 35-314
View the alignment between query and template
View the model in PyMOL
Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 14-214
View the alignment between query and template
View the model in PyMOL