Citrus Sinensis ID: 036131

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MGCRCSTSGARTTAAAHAQAKPDCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLSCER
ccccccccccccccccccccccccccccccEEcccccccccccccccccEEEEccccccccccccccccEEEEEEEEccEEEEEEEEcccccccccccccccccccccccEEEEccccEEEEEccccEEEEEcccccccEEEcEEccccccccccccccccccccEEEcccccccEEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccEEEEEEEEccccHHHHHcccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHcccccEEcccccccEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEcEEcccccEEEEEEEcccccHHHHHcccccccccc
cccccccccccccccccccccccccccccccEEcccccccccccccccEEEEEccccccccccEEccccEEEEEEEcccEEEEEccccHHccccccccccccccccccccEEEcccccEEEEEEcccEEEEEcccccccEEEEEEEEccccccccccccccccccEcccccccccEEEEEEEccccccccccccccEEEEEEcccEEEcccccccccccccccEEEEEEEcccccHHHccccccccccccccEcccccccEEEEccccccccccccccccccHHcccccccccccEEEcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccEEEEEcHHHHHHHHHcccHEEccccccEEEEEEEccccEEEEEEcEEccHHHHHHHHHHHHHHHHHHcHHHHHHHcccccEEccEEEEEEcccccHHHHHcccccccccc
mgcrcstsgaRTTAAAHaqakpdcpnrcgdveisypfgtrpgcflneeflitcndthfkppkpfltkssiEVVNISIDGHLNVLQYTAkdcynakgysvdsnlpsitlskftvsntenrfvviGCDSYAYVRGYLgenryragcmslcdsfdfvtngscigtgccqieiprglkgLEVEAssfnnhenvssfnpctyafvvdesqfhftpsylavggipekfpvvldWEITTIEICEEAKicglnascdkpkdntttssgyhckcnkgyegnpylsdgchdvnecedpslnncthicdnipgsytcrcrkgfrgdgrkdgggctrnQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSKlqgrssekakiFTEEEIKTVTNNyadmigcggsglvykgflsnktpvavkkskivdqTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKkgnlscer
MGCRCSTSGARTTAAahaqakpdcpnrcGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKftvsntenrfvvigCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFrgdgrkdgggctRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSklqgrssekakifteeeiKTVTNNYADMIGCGGSGLVYKGFLSNKtpvavkkskivdqtkmdeFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFeqihkkgnlscer
MGCRCStsgarttaaahaqaKPDCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTcrcrkgfrgdgrkdgggcTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLSCER
*************************NRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCD********SSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQ**********************IFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIH*********
****************************GDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFF************************IFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIH*********
***********************CPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQEL**********AKIFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLSCER
**********************DCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCRCSTSGARTTAAAHAQAKPDCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFVVDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDGGGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLSCER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query499 2.2.26 [Sep-21-2011]
Q9LMP1 732 Wall-associated receptor yes no 0.921 0.628 0.431 1e-103
Q39191 735 Wall-associated receptor no no 0.919 0.624 0.393 1e-91
Q9LMN7 733 Wall-associated receptor no no 0.917 0.624 0.402 4e-90
Q9LMN8 741 Wall-associated receptor no no 0.909 0.612 0.398 2e-89
Q9LMN6 738 Wall-associated receptor no no 0.913 0.617 0.396 7e-87
Q9LMT9 764 Putative wall-associated no no 0.891 0.582 0.343 3e-63
Q9SA25 720 Wall-associated receptor no no 0.867 0.601 0.336 6e-60
Q9LN59 788 Putative wall-associated no no 0.867 0.549 0.338 1e-58
Q9M092 786 Wall-associated receptor no no 0.869 0.552 0.347 1e-58
Q7X8C5 748 Wall-associated receptor no no 0.893 0.596 0.330 7e-57
>sp|Q9LMP1|WAK2_ARATH Wall-associated receptor kinase 2 OS=Arabidopsis thaliana GN=WAK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  376 bits (965), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 212/491 (43%), Positives = 303/491 (61%), Gaps = 31/491 (6%)

Query: 13  TAAAHAQAKPDCPNRCGDVEISYPFGTRPGCFL--NEEFLITCNDTHFKPPKPFLTKSSI 70
           T     Q + +C  RCG+V + YPFGT PGC+   +E F +TCN+      K F    ++
Sbjct: 18  TQLVKGQPRKECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQE----KLFF--GNM 71

Query: 71  EVVNISIDGHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAY 130
            V+N+S+ G L V    ++ CY+++G   D      TL  FT+S   NRF V+GC+SYA+
Sbjct: 72  PVINMSLSGQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSEL-NRFTVVGCNSYAF 130

Query: 131 VRGYLGENRYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVS 190
           +R   G  +Y  GC+S+CDS     NGSC G GCCQI +PRG   + V+  SF+NH  V 
Sbjct: 131 LRTS-GVEKYSTGCISICDSAT-TKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVH 188

Query: 191 SFNPCTYAFVVDESQFHFTP-SYLAVGGIPEKFPVVLDWEI--TTIEICEEAKICGLNAS 247
            FNPCTYAF+V++  F F     L        FPVVLDW I   T +  E   +CG N++
Sbjct: 189 LFNPCTYAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNST 248

Query: 248 CDKPKDNTTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTH--ICDNIPGSYT 305
           C     ++T  +GY+CKC +G+EGNPYL +GC D+NEC   S +NC+    C+N  GS+ 
Sbjct: 249 CF----DSTGGTGYNCKCLEGFEGNPYLPNGCQDINECIS-SRHNCSEHSTCENTKGSFN 303

Query: 306 CRCRKGFRGDGRKDGGGCTRN----QYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHM 361
           C C  G+R D       CTR      +   ++ LG  I F V ++ IS L      R++ 
Sbjct: 304 CNCPSGYRKDSLNS---CTRKVRPEYFRWTQIFLGTTIGFSVIMLGISCLQQKIKHRKNT 360

Query: 362 KLKEKFFEQNGGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYAD--MIGCGGSGLVY 419
           +L++KFFEQNGG +L Q +S   G S+   KIFTE+ +K  TN Y +  ++G GG G VY
Sbjct: 361 ELRQKFFEQNGGGMLIQRVSG-AGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVY 419

Query: 420 KGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEF 479
           KG L + + VA+KK+++ +++++++FINE++V+SQIN RNVV++LGCCLET+VPLLVYEF
Sbjct: 420 KGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEF 479

Query: 480 VGNGTLFEQIH 490
           + +GTLF+ +H
Sbjct: 480 INSGTLFDHLH 490
Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. Binding to pectin may have significance in the control of cell expansion, morphogenesis and development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMT9|WAKLL_ARATH Putative wall-associated receptor kinase-like 13 OS=Arabidopsis thaliana GN=WAKL13 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-like 11 OS=Arabidopsis thaliana GN=WAKL11 PE=3 SV=2 Back     alignment and function description
>sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17 OS=Arabidopsis thaliana GN=WAKL17 PE=3 SV=2 Back     alignment and function description
>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
255558508 1433 ATP binding protein, putative [Ricinus c 0.923 0.321 0.535 1e-141
225459705 742 PREDICTED: wall-associated receptor kina 0.941 0.633 0.523 1e-130
359492353 820 PREDICTED: wall-associated receptor kina 0.939 0.571 0.490 1e-127
359492355 745 PREDICTED: wall-associated receptor kina 0.931 0.624 0.490 1e-127
359492347 722 PREDICTED: wall-associated receptor kina 0.917 0.634 0.492 1e-126
224092689 743 predicted protein [Populus trichocarpa] 0.965 0.648 0.464 1e-126
225456209 736 PREDICTED: wall-associated receptor kina 0.935 0.634 0.483 1e-125
359493507 713 PREDICTED: wall-associated receptor kina 0.907 0.635 0.466 1e-122
449453095 1706 PREDICTED: uncharacterized protein LOC10 0.941 0.275 0.455 1e-122
449492836 624 PREDICTED: wall-associated receptor kina 0.949 0.759 0.451 1e-121
>gi|255558508|ref|XP_002520279.1| ATP binding protein, putative [Ricinus communis] gi|223540498|gb|EEF42065.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  508 bits (1309), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 256/478 (53%), Positives = 339/478 (70%), Gaps = 17/478 (3%)

Query: 24   CPNRCGDVEISYPFGTRPGCFLNEEFLITCND--THFKPPKPFLTKSSIEVVNISIDGHL 81
            CP+RCG+V I YPFG   GC+L+ EFLITCND  T    P P+L KS+I+V NIS+DG L
Sbjct: 740  CPDRCGNVSIPYPFGIE-GCYLSPEFLITCNDSLTANSTPVPYLRKSNIKVTNISLDGRL 798

Query: 82   NVLQYTAKDCYNAKGYSVDS-NLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRY 140
             ++Q  A+DCYN  G          +TLSKFT+S + N+F VIGCDSYAY+ G+     Y
Sbjct: 799  EIVQVAARDCYNKSGIRQPGFRRRFLTLSKFTISKSHNKFTVIGCDSYAYLDGFRYGKFY 858

Query: 141  RAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYAFV 200
            R+GCMSLC   D V   SC G+GCCQIEIP GL      A SF NH N+SSFNPCTYAF+
Sbjct: 859  RSGCMSLCADPDLVDGKSCSGSGCCQIEIPDGLYHANATAYSFKNHTNISSFNPCTYAFI 918

Query: 201  VDESQFHFTPSYLAVGGIPEKFPVVLDWEITTIEICEEAKICGLNASCDKPKDNTTTSSG 260
            V++S+F+F+  YL      ++FP+VLDW +           C  +A+  +P +N    SG
Sbjct: 919  VEDSRFNFSFEYLENIPTDKEFPMVLDWAVNNT----LKHACKDHANSYQPDNN----SG 970

Query: 261  YHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCTHICDNIPGSYTCRCRKGFRGDGRKDG 320
            Y CKC +GY+GNPYL  GC DVNEC++ + N CT  C N+ GSYTC C KG+ GDGRKDG
Sbjct: 971  YLCKCQEGYQGNPYL--GCEDVNECKNENQNKCTDRCTNLDGSYTCSCPKGYHGDGRKDG 1028

Query: 321  GGCTRNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILQQEL 380
             GC  +Q ++IK+ LGVGI F+V I+  SW++ +  +R+ +KLKEKF+++NGG+ILQQ+L
Sbjct: 1029 QGCIPDQLSLIKIILGVGIGFIVFIVVSSWIYLVLRKRKLIKLKEKFYQKNGGAILQQKL 1088

Query: 381  SKLQGRSSEKAKIFTEEEIKTVTNNY--ADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVD 438
            S+  G +++ AK+FT EE+K  TNNY  +++IG GG G VYKG +++   VA+KKS+ VD
Sbjct: 1089 SRRDG-NTDAAKVFTAEELKKATNNYDESNIIGKGGFGTVYKGIVTDNRVVAIKKSRTVD 1147

Query: 439  QTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLS 496
            Q ++++FINE++V+SQIN RNVVRLLGCCLET+VPLLVYEF+ NGTLF+ IH + N S
Sbjct: 1148 QAQVEQFINEVIVLSQINHRNVVRLLGCCLETEVPLLVYEFITNGTLFDYIHCESNAS 1205

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459705|ref|XP_002284700.1| PREDICTED: wall-associated receptor kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492353|ref|XP_002284691.2| PREDICTED: wall-associated receptor kinase 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492355|ref|XP_002284688.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492347|ref|XP_003634400.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224092689|ref|XP_002309699.1| predicted protein [Populus trichocarpa] gi|222855675|gb|EEE93222.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456209|ref|XP_002282887.1| PREDICTED: wall-associated receptor kinase 2-like isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493507|ref|XP_002263295.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449453095|ref|XP_004144294.1| PREDICTED: uncharacterized protein LOC101209380 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449492836|ref|XP_004159116.1| PREDICTED: wall-associated receptor kinase 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query499
TAIR|locus:2014912 732 WAK2 "wall-associated kinase 2 0.909 0.620 0.424 1.7e-98
TAIR|locus:2014962 733 WAK5 "wall associated kinase 5 0.903 0.615 0.395 1.4e-87
TAIR|locus:2014902 735 WAK1 "cell wall-associated kin 0.899 0.610 0.384 3.3e-86
TAIR|locus:2014952 738 WAK4 "wall associated kinase 4 0.909 0.615 0.390 1e-84
TAIR|locus:2014897 741 WAK3 "wall associated kinase 3 0.905 0.609 0.390 2.1e-84
TAIR|locus:2030988 764 AT1G17910 [Arabidopsis thalian 0.707 0.462 0.372 3.9e-66
TAIR|locus:2126316 786 AT4G31100 [Arabidopsis thalian 0.659 0.418 0.369 1.5e-65
TAIR|locus:2016377 788 AT1G19390 [Arabidopsis thalian 0.645 0.408 0.372 1.6e-65
TAIR|locus:2032875 720 AT1G16260 [Arabidopsis thalian 0.280 0.194 0.486 6.9e-63
TAIR|locus:2200527 642 WAKL6 "wall associated kinase- 0.887 0.690 0.344 1.3e-59
TAIR|locus:2014912 WAK2 "wall-associated kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 978 (349.3 bits), Expect = 1.7e-98, P = 1.7e-98
 Identities = 204/481 (42%), Positives = 297/481 (61%)

Query:    21 KPDCPNRCGDVEISYPFGTRPGCFL--NEEFLITCNDTHFKPPKPFLTKSSIEVVNISID 78
             + +C  RCG+V + YPFGT PGC+   +E F +TCN+      K F    ++ V+N+S+ 
Sbjct:    26 RKECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQE----KLFF--GNMPVINMSLS 79

Query:    79 GHLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDSYAYVRGYLGEN 138
             G L V    ++ CY+++G   D      TL  FT+S   NRF V+GC+SYA++R   G  
Sbjct:    80 GQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSEL-NRFTVVGCNSYAFLRTS-GVE 137

Query:   139 RYRAGCMSLCDSFDFVTNGSCIGTGCCQIEIPRGLKGLEVEASSFNNHENVSSFNPCTYA 198
             +Y  GC+S+CDS     NGSC G GCCQI +PRG   + V+  SF+NH  V  FNPCTYA
Sbjct:   138 KYSTGCISICDSAT-TKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVHLFNPCTYA 196

Query:   199 FVVDESQFHFTPSYLAVGGIPE--KFPVVLDWEI--TTIEICEEAKICGLNASCDKPKDN 254
             F+V++  F F  +   +  +     FPVVLDW I   T +  E   +CG N++C     +
Sbjct:   197 FLVEDGMFDFH-ALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNSTCF----D 251

Query:   255 TTTSSGYHCKCNKGYEGNPYLSDGCHDVNECEDPSLNNCT-H-ICDNIPGSYTXXXXXXX 312
             +T  +GY+CKC +G+EGNPYL +GC D+NEC   S +NC+ H  C+N  GS+        
Sbjct:   252 STGGTGYNCKCLEGFEGNPYLPNGCQDINECIS-SRHNCSEHSTCENTKGSFNCNCPSGY 310

Query:   313 XXXXXXXXXXXTRNQY-TVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQN 371
                         R +Y    ++ LG  I F V ++ IS L      R++ +L++KFFEQN
Sbjct:   311 RKDSLNSCTRKVRPEYFRWTQIFLGTTIGFSVIMLGISCLQQKIKHRKNTELRQKFFEQN 370

Query:   372 GGSILQQELSKLQGRSSEKAKIFTEEEIKTVTNNYAD--MIGCGGSGLVYKGFLSNKTPV 429
             GG +L Q +S   G S+   KIFTE+ +K  TN Y +  ++G GG G VYKG L + + V
Sbjct:   371 GGGMLIQRVSGA-GPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIV 429

Query:   430 AVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQI 489
             A+KK+++ +++++++FINE++V+SQIN RNVV++LGCCLET+VPLLVYEF+ +GTLF+ +
Sbjct:   430 AIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHL 489

Query:   490 H 490
             H
Sbjct:   490 H 490
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009751 "response to salicylic acid stimulus" evidence=IDA
GO:0009311 "oligosaccharide metabolic process" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0009992 "cellular water homeostasis" evidence=IMP;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TAIR|locus:2014962 WAK5 "wall associated kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014902 WAK1 "cell wall-associated kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014952 WAK4 "wall associated kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014897 WAK3 "wall associated kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030988 AT1G17910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126316 AT4G31100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016377 AT1G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032875 AT1G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200527 WAKL6 "wall associated kinase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
pfam13947106 pfam13947, GUB_WAK_bind, Wall-associated receptor 4e-33
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 3e-14
cd00180 215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-14
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-13
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-13
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-12
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 3e-11
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 7e-10
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-09
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 7e-09
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 8e-09
cd05085 250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-08
cd05112 256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-08
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-08
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 8e-08
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-07
cd05060 257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 2e-07
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-07
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-06
cd05058 262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-06
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 6e-06
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-05
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-05
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-05
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-05
cd05033 266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-05
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 4e-05
cd05035 273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 5e-05
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 5e-05
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 7e-05
cd05116 257 cd05116, PTKc_Syk, Catalytic domain of the Protein 7e-05
cd05059 256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 9e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-05
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 9e-05
cd05036 277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-04
cd05050 288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-04
cd05045 290 cd05045, PTKc_RET, Catalytic domain of the Protein 1e-04
cd05051 296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-04
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 2e-04
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 2e-04
cd05068 261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-04
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 2e-04
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-04
cd05040 257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 3e-04
cd05075 272 cd05075, PTKc_Axl, Catalytic domain of the Protein 3e-04
cd05063 268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-04
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 6e-04
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 8e-04
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 8e-04
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.001
cd05097 295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 0.001
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 0.001
cd05062 277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 0.001
pfam1294736 pfam12947, EGF_3, EGF domain 0.002
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.002
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 0.002
cd01475224 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin 0.003
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 0.003
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.003
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.004
>gnl|CDD|222467 pfam13947, GUB_WAK_bind, Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
 Score =  121 bits (305), Expect = 4e-33
 Identities = 44/108 (40%), Positives = 67/108 (62%), Gaps = 3/108 (2%)

Query: 21  KPDCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISI-DG 79
            P CP+RCG+V I YPFG  PGC  +  F +TCN+T   PP+  L   + EV++IS+ +G
Sbjct: 1   LPGCPDRCGNVSIPYPFGIGPGCARDPGFELTCNNT-TSPPRLLLGNGNYEVLSISLANG 59

Query: 80  HLNVLQYTAKDCYNAKGYSVDSNLPSITLSKFTVSNTENRFVVIGCDS 127
            + VL   + +CYN+ G   D+   S+    F  S++ N+FVV+GC++
Sbjct: 60  TVRVLDPISSNCYNSSGKRTDNGSLSLGGP-FFFSSSRNKFVVVGCNT 106

This cysteine-rich GUB_WAK_bind domain is the extracellular part of this serine/threonine kinase that binds to the cell-wall pectins. Length = 106
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 499
PF13947106 GUB_WAK_bind: Wall-associated receptor kinase gala 99.95
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.81
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.74
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.69
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.66
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.64
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.59
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.58
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.58
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.57
PF08488103 WAK: Wall-associated kinase; InterPro: IPR013695 T 99.56
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.53
KOG3653 534 consensus Transforming growth factor beta/activin 99.51
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.48
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.47
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.46
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.44
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.4
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.38
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.35
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.33
PHA02988 283 hypothetical protein; Provisional 99.3
KOG0605 550 consensus NDR and related serine/threonine kinases 99.29
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 99.26
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.26
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.26
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.26
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.24
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.24
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.22
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.22
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.21
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.19
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.19
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.19
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.18
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.18
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.18
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.17
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.17
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.17
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.16
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.16
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.16
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.16
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.16
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.15
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.15
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.15
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.15
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.14
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.14
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.14
KOG0198 313 consensus MEKK and related serine/threonine protei 99.14
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.13
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.13
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.13
KOG0586 596 consensus Serine/threonine protein kinase [General 99.13
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.13
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.12
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.12
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.11
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.11
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.11
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.11
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.11
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.1
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.1
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.1
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.1
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.1
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.1
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.09
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.09
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.09
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.09
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.09
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.08
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.08
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.07
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.07
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.06
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.06
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.06
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.06
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.06
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.05
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.05
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.05
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.05
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.04
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.04
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.04
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.04
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.04
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.03
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.03
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.03
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.03
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.03
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.03
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.02
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.02
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.02
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.02
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.02
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.02
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.02
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.02
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.02
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.02
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.02
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.02
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.01
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.01
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.01
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.01
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.01
PTZ00267 478 NIMA-related protein kinase; Provisional 99.01
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.01
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.01
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.0
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.0
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.0
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 98.99
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 98.99
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 98.99
KOG1989 738 consensus ARK protein kinase family [Signal transd 98.99
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.99
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 98.99
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 98.99
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 98.99
KOG0661 538 consensus MAPK related serine/threonine protein ki 98.98
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 98.98
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 98.98
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 98.98
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.98
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 98.97
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 98.97
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 98.97
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.97
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.97
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 98.97
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 98.97
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 98.97
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 98.96
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 98.96
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 98.96
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 98.96
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.96
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 98.96
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 98.96
PLN00034 353 mitogen-activated protein kinase kinase; Provision 98.95
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 98.95
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 98.95
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 98.95
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.95
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 98.95
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 98.95
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.95
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 98.95
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 98.95
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 98.94
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 98.94
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 98.94
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 98.94
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 98.94
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 98.94
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 98.94
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 98.93
KOG0578 550 consensus p21-activated serine/threonine protein k 98.93
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.93
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 98.93
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.93
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.93
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 98.93
KOG0201 467 consensus Serine/threonine protein kinase [Signal 98.93
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 98.93
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 98.93
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 98.93
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 98.92
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 98.92
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 98.92
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 98.92
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 98.92
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 98.92
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 98.92
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 98.92
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.92
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 98.92
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 98.92
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.92
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 98.92
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 98.92
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 98.91
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 98.91
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 98.91
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 98.91
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 98.91
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 98.91
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.91
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 98.91
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 98.91
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 98.9
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.9
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 98.9
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 98.9
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 98.9
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 98.9
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 98.9
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.9
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 98.9
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 98.89
KOG0582 516 consensus Ste20-like serine/threonine protein kina 98.89
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 98.89
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 98.89
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 98.89
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 98.89
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 98.89
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 98.88
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 98.88
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 98.88
KOG0610 459 consensus Putative serine/threonine protein kinase 98.88
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.88
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 98.88
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.87
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 98.87
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 98.87
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 98.87
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 98.87
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 98.87
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 98.87
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 98.87
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.87
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 98.87
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 98.87
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.87
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 98.87
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.86
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.86
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 98.86
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 98.86
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 98.85
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 98.85
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 98.85
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 98.85
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 98.85
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 98.85
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 98.85
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 98.84
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 98.84
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.84
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 98.84
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 98.84
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 98.84
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.83
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.83
PTZ00266 1021 NIMA-related protein kinase; Provisional 98.83
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 98.83
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 98.82
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.82
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 98.82
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 98.81
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 98.81
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.81
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.81
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.81
KOG0694 694 consensus Serine/threonine protein kinase [Signal 98.81
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.8
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 98.8
PHA03212 391 serine/threonine kinase US3; Provisional 98.8
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 98.8
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 98.8
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.79
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 98.79
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 98.79
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 98.79
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 98.79
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.78
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 98.78
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 98.78
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.77
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 98.77
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.77
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 98.76
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 98.76
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 98.76
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 98.76
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.76
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.75
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 98.75
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 98.74
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 98.74
PLN00009 294 cyclin-dependent kinase A; Provisional 98.74
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.73
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 98.72
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 98.72
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.71
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.71
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 98.7
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.7
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 98.7
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 98.7
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 98.7
KOG0589 426 consensus Serine/threonine protein kinase [General 98.69
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.69
PTZ00283 496 serine/threonine protein kinase; Provisional 98.69
PRK10345 210 hypothetical protein; Provisional 98.69
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.69
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.68
PRK09188 365 serine/threonine protein kinase; Provisional 98.68
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 98.67
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 98.66
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.66
KOG0584 632 consensus Serine/threonine protein kinase [General 98.66
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 98.66
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 98.65
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 98.65
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.64
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.64
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.64
KOG0577 948 consensus Serine/threonine protein kinase [Signal 98.64
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 98.64
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.64
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.64
PHA03211 461 serine/threonine kinase US3; Provisional 98.64
PHA03207 392 serine/threonine kinase US3; Provisional 98.64
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.62
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.61
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 98.6
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.6
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.6
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.59
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 98.59
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.59
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.59
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.58
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 98.58
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.58
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.57
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.57
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.55
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.55
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.55
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.55
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 98.54
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.54
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 98.53
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.53
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 98.53
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.53
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.52
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 98.52
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.51
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.5
PTZ00036 440 glycogen synthase kinase; Provisional 98.5
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 98.49
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.48
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.48
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.48
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.48
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 98.48
KOG1152 772 consensus Signal transduction serine/threonine kin 98.48
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.48
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 98.48
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 98.48
PHA03209 357 serine/threonine kinase US3; Provisional 98.47
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 98.47
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.47
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.46
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 98.45
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.45
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.45
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.43
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.43
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 98.41
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.4
PTZ00284 467 protein kinase; Provisional 98.39
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 98.38
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.37
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.37
TIGR03724 199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.34
PRK14879 211 serine/threonine protein kinase; Provisional 98.3
KOG1219 4289 consensus Uncharacterized conserved protein, conta 98.3
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.29
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.28
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.27
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.23
KOG0695 593 consensus Serine/threonine protein kinase [Signal 98.22
PHA03210 501 serine/threonine kinase US3; Provisional 98.22
KOG0596 677 consensus Dual specificity; serine/threonine and t 98.22
KOG0696 683 consensus Serine/threonine protein kinase [Signal 98.21
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.16
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 98.12
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.1
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 98.09
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 98.07
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 98.06
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 98.0
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 97.9
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 97.81
KOG1027 903 consensus Serine/threonine protein kinase and endo 97.81
smart00090237 RIO RIO-like kinase. 97.79
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 97.76
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.65
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 97.6
KOG1214 1289 consensus Nidogen and related basement membrane pr 97.6
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 97.48
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 97.44
PRK12274 218 serine/threonine protein kinase; Provisional 97.41
PHA02882 294 putative serine/threonine kinase; Provisional 97.38
KOG1167 418 consensus Serine/threonine protein kinase of the C 97.31
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 97.26
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 97.25
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 97.2
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 97.19
COG0515 384 SPS1 Serine/threonine protein kinase [General func 97.12
PF1266224 cEGF: Complement Clr-like EGF-like 97.03
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.03
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 97.03
KOG1290 590 consensus Serine/threonine protein kinase [Signal 96.95
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 96.79
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 96.75
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 96.74
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 96.73
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 96.71
KOG1219 4289 consensus Uncharacterized conserved protein, conta 96.67
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 96.65
KOG4260350 consensus Uncharacterized conserved protein [Funct 96.64
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 96.53
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 96.48
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.27
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 95.96
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 95.54
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 95.42
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 95.06
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 94.91
COG0661 517 AarF Predicted unusual protein kinase [General fun 94.63
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 94.37
KOG4260350 consensus Uncharacterized conserved protein [Funct 94.28
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.21
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.06
PHA03099139 epidermal growth factor-like protein (EGF-like pro 93.92
KOG1214 1289 consensus Nidogen and related basement membrane pr 93.8
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 93.45
PF0000832 EGF: EGF-like domain This is a sub-family of the P 93.22
KOG1235 538 consensus Predicted unusual protein kinase [Genera 92.83
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 92.45
smart0018135 EGF Epidermal growth factor-like domain. 92.43
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 92.42
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 92.26
cd0005336 EGF Epidermal growth factor domain, found in epide 92.26
KOG1243 690 consensus Protein kinase [General function predict 92.17
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 92.08
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 91.87
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 90.99
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 90.71
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 90.52
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 90.33
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 90.3
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 90.24
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 89.85
PRK10593 297 hypothetical protein; Provisional 89.31
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 89.05
COG3642 204 Mn2+-dependent serine/threonine protein kinase [Si 88.99
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 87.2
PRK09550 401 mtnK methylthioribose kinase; Reviewed 86.97
PF0000832 EGF: EGF-like domain This is a sub-family of the P 86.88
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 84.92
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 84.8
smart0018135 EGF Epidermal growth factor-like domain. 84.68
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 84.32
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 84.3
cd0005336 EGF Epidermal growth factor domain, found in epide 83.93
PHA03099139 epidermal growth factor-like protein (EGF-like pro 83.8
COG0478304 RIO-like serine/threonine protein kinase fused to 83.49
KOG1217487 consensus Fibrillins and related proteins containi 83.36
PF01636 239 APH: Phosphotransferase enzyme family This family 82.84
TIGR02172 226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 82.7
PLN02876 822 acyl-CoA dehydrogenase 82.33
KOG0590 601 consensus Checkpoint kinase and related serine/thr 81.98
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 81.06
>PF13947 GUB_WAK_bind: Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
Probab=99.95  E-value=8.7e-29  Score=203.57  Aligned_cols=104  Identities=40%  Similarity=0.855  Sum_probs=89.9

Q ss_pred             CCCCCCCCCCeecccCCCCCCCCCCCCCceeEeCCCCCCCCcccccCCCceEEEEee-eceEEEEeeecccccCCCcccc
Q 036131           21 KPDCPNRCGDVEISYPFGTRPGCFLNEEFLITCNDTHFKPPKPFLTKSSIEVVNISI-DGHLNVLQYTAKDCYNAKGYSV   99 (499)
Q Consensus        21 ~~~C~~~CG~v~i~yPFGig~~C~~~~~F~l~C~~~~~~~p~l~l~~~~~~v~~is~-~~~~~v~~~~~~~c~~~~~~~~   99 (499)
                      +|+||++||||+||||||||+||+++|+|+|+|++++. +|+|++.+..+||++|++ +++++|..++++.|+.......
T Consensus         1 ~~~C~~~CGnv~IpYPFgi~~~C~~~~~F~L~C~~~~~-~~~l~l~~~~~~V~~I~~~~~~i~v~~~~~~~~~~~~~~~~   79 (106)
T PF13947_consen    1 KPGCPSSCGNVSIPYPFGIGPGCGRDPGFELTCNNNTS-PPKLLLSSGNYEVLSISYENGTIRVSDPISSNCYSSSSSNS   79 (106)
T ss_pred             CCCCCCccCCEeecCCCccCCCCCCCCCcEEECCCCCC-CceeEecCCcEEEEEEecCCCEEEEEeccccceecCCCCcc
Confidence            68999999999999999999999999999999998875 889999889999999999 9999999999999887732222


Q ss_pred             -cccCCCcCCcceEEecCCCeEEEEccce
Q 036131          100 -DSNLPSITLSKFTVSNTENRFVVIGCDS  127 (499)
Q Consensus       100 -~~~~~~~~~~~f~~s~~~N~~~~~GC~~  127 (499)
                       ...| ++.+ ||.+|+++|+|+++||++
T Consensus        80 ~~~~~-~~~~-~~~~s~~~N~~~~~GC~t  106 (106)
T PF13947_consen   80 SNSNL-SLNG-PFFFSSSSNKFTVVGCNT  106 (106)
T ss_pred             cccEE-eecC-CceEccCCcEEEEECCCC
Confidence             2233 4444 899999999999999985

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF08488 WAK: Wall-associated kinase; InterPro: IPR013695 This domain is found together with the eukaryotic protein kinase domain IPR000719 from INTERPRO in plant wall-associated kinases (WAKs) and related proteins Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-08
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 5e-08
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 8e-08
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 8e-08
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 1e-07
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 4e-07
4f1m_A 287 Crystal Structure Of The G1179s Roco4 Kinase Domain 6e-07
4f1o_A 287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 6e-07
4f0f_A 287 Crystal Structure Of The Roco4 Kinase Domain Bound 7e-07
3qgw_A 286 Crystal Structure Of Itk Kinase Bound To An Inhibit 9e-07
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-06
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-06
4hct_A 269 Crystal Structure Of Itk In Complex With Compound 5 4e-06
3v5j_A 266 Crystal Structure Of Interleukin-2 Inducible T-Cell 5e-06
3miy_A 266 X-Ray Crystal Structure Of Itk Complexed With Sunit 5e-06
1sm2_A 264 Crystal Structure Of The Phosphorylated Interleukin 5e-06
3t9t_A 267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-05
2pl0_A 289 Lck Bound To Imatinib Length = 289 6e-05
3qrj_A 277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-04
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 1e-04
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-04
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 1e-04
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-04
3dk7_A 277 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-04
2hzi_A 277 Abl Kinase Domain In Complex With Pd180970 Length = 1e-04
3qri_A 277 The Crystal Structure Of Human Abl1 Kinase Domain I 1e-04
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-04
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-04
2gqg_A 278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 1e-04
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 1e-04
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 1e-04
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 2e-04
2hz0_A 270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 2e-04
2hyy_A 273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-04
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-04
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-04
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-04
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-04
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 2e-04
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 2e-04
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 2e-04
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 2e-04
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-04
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-04
4i1z_A 329 Crystal Structure Of The Monomeric (v948r) Form Of 2e-04
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 2e-04
4i21_A 329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 2e-04
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 2e-04
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 2e-04
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 2e-04
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-04
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-04
3w2o_A 331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 3e-04
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-04
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 3e-04
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-04
4i20_A 329 Crystal Structure Of Monomeric (v948r) Primary Onco 3e-04
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 3e-04
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 3e-04
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 3e-04
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 3e-04
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 3e-04
2eb3_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 3e-04
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 3e-04
2itt_A 327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 3e-04
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 3e-04
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 3e-04
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 3e-04
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 3e-04
3bys_A 277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 3e-04
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 3e-04
3bel_A 315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 4e-04
3lzb_A 327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-04
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 4e-04
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 5e-04
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 5e-04
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 6e-04
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 6e-04
2ofu_A 273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 6e-04
3lck_A 271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 7e-04
3bym_A 272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 7e-04
2of2_A 271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 7e-04
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 7e-04
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 7e-04
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 7e-04
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 7e-04
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 7e-04
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-04
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 7e-04
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-04
3c1x_A 373 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-04
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 7e-04
3a4p_A 319 Human C-Met Kinase Domain Complexed With 6-Benzylox 8e-04
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 8e-04
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 8e-04
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 8e-04
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 8e-04
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 8e-04
2og8_A 265 Crystal Structure Of Aminoquinazoline 36 Bound To L 8e-04
4gg5_A 319 Crystal Structure Of Cmet In Complex With Novel Inh 8e-04
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 8e-04
2g15_A 318 Structural Characterization Of Autoinhibited C-Met 8e-04
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 8e-04
2wd1_A 292 Human C-Met Kinase In Complex With Azaindole Inhibi 8e-04
3mpm_A 267 Lck Complexed With A Pyrazolopyrimidine Length = 26 8e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (60%), Gaps = 3/99 (3%)
Query: 390 KAKIFTEEEIKTVTNNYAD--MIGCGGSGLVYKGFLSNKTPVAVKKSKI-VDQTKMDEFI 446
           + K F+  E++  ++N+++  ++G GG G VYKG L++ T VAVK+ K    Q    +F 
Sbjct: 24  QLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQ 83
Query: 447 NELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTL 485
            E+ ++S    RN++RL G C+     LLVY ++ NG++
Sbjct: 84  TEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSV 122
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query499
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-26
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 1e-26
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-24
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-17
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 7e-09
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-16
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 8e-15
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-07
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-14
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 6e-10
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-05
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 2e-14
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-14
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-09
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 5e-14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-13
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 7e-12
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-13
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-13
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 3e-08
3soc_A 322 Activin receptor type-2A; structural genomics cons 6e-13
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-12
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-12
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-12
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-12
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-12
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 2e-12
4aoj_A 329 High affinity nerve growth factor receptor; transf 2e-12
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 3e-12
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 3e-12
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 3e-12
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-12
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 3e-12
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 4e-12
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 4e-12
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 5e-12
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 8e-12
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 9e-12
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 9e-12
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-11
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 1e-11
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-11
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-11
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 2e-11
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-11
3pls_A 298 Macrophage-stimulating protein receptor; protein k 3e-11
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 3e-11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 6e-06
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-11
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 3e-11
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-11
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 5e-11
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 5e-11
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 6e-11
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 7e-11
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-10
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 1e-10
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-10
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-10
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-10
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 2e-10
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-10
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 3e-10
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 3e-10
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-10
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-10
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 6e-10
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 7e-10
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 8e-10
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 9e-10
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-09
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-09
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-09
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-09
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-09
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-09
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-09
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-09
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-09
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 3e-09
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 4e-09
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 5e-09
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-09
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-09
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-09
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-04
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 1e-08
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 2e-08
3q4u_A 301 Activin receptor type-1; structural genomics conso 2e-08
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 2e-08
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 3e-08
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 4e-08
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 4e-08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-08
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 5e-08
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 6e-04
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 5e-08
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 8e-08
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 9e-08
3v65_B 386 Low-density lipoprotein receptor-related protein; 1e-07
3v65_B 386 Low-density lipoprotein receptor-related protein; 6e-05
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-06
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-07
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-07
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-07
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-07
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 3e-07
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 3e-07
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 5e-07
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 7e-07
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 9e-07
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-06
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 1e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-06
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 2e-06
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 3e-06
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 3e-06
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-06
2vh0_B134 Activated factor XA light chain; serine protease, 3e-06
2vh0_B134 Activated factor XA light chain; serine protease, 4e-05
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-06
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 5e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 6e-06
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 8e-06
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 9e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 9e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-04
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 1e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-04
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 1e-05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-05
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-05
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-05
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 3e-05
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-05
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 3e-05
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 3e-05
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 4e-05
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-05
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 5e-05
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 5e-05
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-05
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-05
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-05
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 6e-05
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 9e-05
1nzi_A159 Complement C1S component; calcium, innate immunity 9e-05
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 1e-04
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-04
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 1e-04
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 2e-04
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-04
3bhy_A 283 Death-associated protein kinase 3; death associate 2e-04
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 3e-04
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 3e-04
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 3e-04
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 4e-04
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 4e-04
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 5e-04
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-04
2a19_B 284 Interferon-induced, double-stranded RNA-activated 6e-04
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 6e-04
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 6e-04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-04
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 8e-04
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 9e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score =  109 bits (274), Expect = 1e-26
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 388 SEKAKIFTEEEIKTVTNNYAD--MIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEF 445
             ++      +++  TNN+    +IG G  G VYKG L +   VA+K+        ++EF
Sbjct: 23  PFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEF 82

Query: 446 INELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGN 494
             E+  +S     ++V L+G C E    +L+Y+++ NG L   ++    
Sbjct: 83  ETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDL 131
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.73
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.72
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.71
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.64
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.61
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.6
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.58
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.57
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.55
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.54
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.54
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.53
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.53
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.52
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.51
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.4
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.39
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.33
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.33
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.33
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.32
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.31
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.31
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.31
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.3
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.29
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.28
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.27
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.26
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.26
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.25
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.25
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.25
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.25
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.25
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.24
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.24
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.24
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.24
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.24
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.24
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.24
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.23
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.23
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.23
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.23
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.23
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.23
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.22
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.22
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.22
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.22
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.21
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.21
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.2
3uqc_A 286 Probable conserved transmembrane protein; structur 99.2
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.2
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.19
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.19
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.19
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.19
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.19
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.19
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.19
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.18
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.18
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.18
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.18
3bhy_A 283 Death-associated protein kinase 3; death associate 99.18
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.18
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.18
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.18
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.17
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.17
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.17
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.17
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.17
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.17
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.16
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.16
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.16
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.16
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.16
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.16
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.16
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.16
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.15
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.15
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.15
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.15
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.15
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.15
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.15
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.15
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.14
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.14
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.14
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.14
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.14
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.14
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.14
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.14
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.14
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.13
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.13
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.13
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.13
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.13
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.13
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.13
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.13
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.13
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.12
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.12
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.12
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.12
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.12
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.12
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.12
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.12
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.12
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.11
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.11
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.11
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.11
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.11
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.11
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.1
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.1
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.1
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.1
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.1
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.1
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.09
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.09
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.09
3niz_A 311 Rhodanese family protein; structural genomics, str 99.09
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.09
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.08
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.08
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.08
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.08
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.08
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.08
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.08
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.08
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.07
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.07
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.07
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.07
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.06
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.06
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.06
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.06
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.05
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.05
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.05
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.04
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.04
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.04
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.04
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.04
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.03
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.03
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.03
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.03
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.03
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.03
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.03
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.02
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.02
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.01
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.01
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.01
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.01
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.01
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.01
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.01
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.0
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.0
3q4u_A 301 Activin receptor type-1; structural genomics conso 98.99
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 98.99
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 98.98
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 98.98
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 98.98
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 98.97
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.97
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 98.97
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 98.97
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 98.96
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 98.96
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 98.96
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.94
3an0_A 340 Dual specificity mitogen-activated protein kinase; 98.94
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 98.94
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 98.93
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 98.93
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.93
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 98.93
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 98.92
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.92
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 98.92
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 98.92
3fme_A 290 Dual specificity mitogen-activated protein kinase; 98.91
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 98.91
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 98.91
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 98.9
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 98.89
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 98.89
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.88
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 98.88
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 98.87
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.87
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 98.86
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 98.86
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 98.85
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 98.85
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 98.85
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.85
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 98.84
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.84
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.84
3aln_A 327 Dual specificity mitogen-activated protein kinase; 98.84
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.84
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.82
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 98.81
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 98.81
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 98.81
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.8
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.79
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.79
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.78
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 98.77
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 98.77
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 98.76
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.75
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 98.73
2dyl_A 318 Dual specificity mitogen-activated protein kinase 98.72
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 98.72
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.71
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.7
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 98.69
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 98.69
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.68
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 98.66
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.65
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.62
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.6
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 98.59
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.58
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 98.57
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 98.56
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.56
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 98.54
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.51
2bou_A143 EGF-like module containing mucin-like hormone rece 98.5
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.5
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.44
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.32
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.27
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.21
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.21
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.2
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.15
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.14
2vh0_B134 Activated factor XA light chain; serine protease, 98.08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.03
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.98
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.96
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 97.92
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.85
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.84
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.8
2bou_A143 EGF-like module containing mucin-like hormone rece 97.77
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.77
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.74
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 97.69
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.63
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.62
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.6
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.36
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.32
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.03
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.03
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.02
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.91
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 96.79
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 96.46
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.22
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.16
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 96.14
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.58
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.48
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.42
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 95.38
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 95.08
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.02
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 94.86
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 94.57
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 94.46
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 94.34
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 94.07
2k2s_B61 Micronemal protein 6; microneme protein complex, c 94.04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 93.97
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 93.8
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 93.65
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 93.53
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 93.48
2wph_E59 Coagulation factor IXA light chain; serine proteas 93.36
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 93.25
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.2
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 93.09
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 92.63
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 92.49
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 92.48
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 92.28
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 92.15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 92.03
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 91.71
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 91.65
1nzi_A159 Complement C1S component; calcium, innate immunity 91.51
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 91.5
1a3p_A45 Epidermal growth factor; disulfide connectivities, 91.37
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 91.26
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 91.2
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 91.02
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 90.94
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 90.13
1szb_A170 Mannose binding lectin-associated serine protease- 90.11
1aut_L114 Activated protein C; serine proteinase, plasma cal 90.03
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 89.96
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 89.67
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 89.59
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 89.29
1a3p_A45 Epidermal growth factor; disulfide connectivities, 88.21
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 87.93
1nql_B53 Epidermal growth factor; cell surface receptor, ty 87.64
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 87.54
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 87.52
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 86.84
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 85.79
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 85.79
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 85.45
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 85.14
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 84.99
2wph_E59 Coagulation factor IXA light chain; serine proteas 84.73
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 84.51
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 84.45
2vh0_B134 Activated factor XA light chain; serine protease, 83.96
3v65_B386 Low-density lipoprotein receptor-related protein; 83.2
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 83.04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 83.03
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 82.77
1ob1_C99 Major merozoite surface protein; immune system, im 81.69
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 81.64
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 81.54
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 81.52
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 81.12
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
Probab=99.73  E-value=3e-18  Score=167.24  Aligned_cols=99  Identities=26%  Similarity=0.395  Sum_probs=83.4

Q ss_pred             CHHHHhhhcccccccccccceeeEEEEEEc------CCCeEEEEEeccC-ChhHHHHHHHHHHHHHcCCCCCceeeeeEE
Q 036131          395 TEEEIKTVTNNYADMIGCGGSGLVYKGFLS------NKTPVAVKKSKIV-DQTKMDEFINELVVVSQINRRNVVRLLGCC  467 (499)
Q Consensus       395 ~~~el~~~~~~~~~~lG~G~fG~Vy~g~~~------~~~~vavK~~~~~-~~~~~~~f~~E~~~l~~l~H~nIv~l~g~~  467 (499)
                      .+.|+......|.+.||+|+||+||+|.+.      +++.||||+++.. +....++|.+|+.+|++|+|||||+|+|++
T Consensus        19 ~~~ei~~~~~~~~~~lG~G~fG~Vykg~~~~~~~~~~~~~VAvK~l~~~~~~~~~~~f~~E~~il~~l~HpNIV~l~g~~   98 (308)
T 4gt4_A           19 KLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLLGVV   98 (308)
T ss_dssp             CCCBCCGGGEEEEEEEEECSSCEEEEEEEC-------CEEEEEEECCC-CCC-CHHHHHHHHHHHHHCCCTTBCCEEEEE
T ss_pred             CcccCCHHHCeEeeEeccCCCcEEEEEEEcCCccCCCCeEEEEEEECcccChHHHHHHHHHHHHHHhCCCCCCCCcceEE
Confidence            344556666778889999999999999863      4678999998753 344567899999999999999999999999


Q ss_pred             EeCCeeEEEEEccCCCChHHHHhcCC
Q 036131          468 LETQVPLLVYEFVGNGTLFEQIHKKG  493 (499)
Q Consensus       468 ~~~~~~~LV~Ey~~~GsL~~~L~~~~  493 (499)
                      .+.+..+||||||++|+|.++|+.++
T Consensus        99 ~~~~~~~lV~Ey~~~G~L~~~L~~~~  124 (308)
T 4gt4_A           99 TKDQPLSMIFSYCSHGDLHEFLVMRS  124 (308)
T ss_dssp             CSSSSCEEEEECCSSCBHHHHHHTTC
T ss_pred             EECCEEEEEEEcCCCCcHHHHHHhhC
Confidence            99999999999999999999997654
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 499
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-18
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-17
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-17
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 5e-17
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 6e-17
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 8e-17
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-16
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-16
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-16
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-16
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-16
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-16
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-16
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 7e-16
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 9e-16
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-15
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-15
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-15
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 4e-15
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-15
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 9e-15
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-14
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-14
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 7e-14
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 8e-14
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-14
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-14
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-13
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-13
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 5e-13
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-13
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-13
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-13
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 9e-13
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-12
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-12
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-12
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-12
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-12
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-11
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-11
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-11
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-11
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-11
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-11
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-11
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-10
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-10
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 4e-10
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 6e-10
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 6e-10
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-09
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-09
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 3e-09
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 6e-09
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-08
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-08
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-08
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 2e-08
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-08
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 5e-08
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 6e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 6e-08
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 1e-07
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-07
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-07
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 3e-07
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 5e-07
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 1e-06
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-06
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 7e-06
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 9e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-05
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 3e-04
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 3e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 3e-04
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 4e-04
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 6e-04
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 9e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.001
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.002
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine protein kinase TAO2
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 82.4 bits (203), Expect = 5e-18
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 9/114 (7%)

Query: 389 EKAKIFTEEEIKTVTNNYADM--IGCGGSGLVYKGF-LSNKTPVAVK---KSKIVDQTKM 442
           + A++F +++ + +   ++D+  IG G  G VY    + N   VA+K    S      K 
Sbjct: 3   DVAELFFKDDPEKL---FSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKW 59

Query: 443 DEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEQIHKKGNLS 496
            + I E+  + ++   N ++  GC L      LV E+            K  L 
Sbjct: 60  QDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQ 113
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query499
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.6
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.6
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.59
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.59
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.57
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.57
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.56
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.56
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.56
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.55
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.55
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.55
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.54
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.53
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.52
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.52
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.51
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.5
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.5
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.5
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.5
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.5
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.49
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.49
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.47
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.47
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.46
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.46
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.46
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.44
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.44
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.42
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.41
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.41
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.39
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.39
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.37
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.35
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.34
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.34
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.33
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.3
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.28
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.27
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.26
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.21
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.17
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.15
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.13
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.11
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.09
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.08
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.08
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.07
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.07
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 98.88
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 98.87
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 98.85
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.32
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.16
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.81
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.5
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.34
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.33
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.3
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.29
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1szba245 Mannose-binding protein associated serine protease 97.14
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.07
d1nt0a345 Mannose-binding protein associated serine protease 97.06
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.03
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.71
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.64
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.6
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 96.23
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.12
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.98
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.92
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.81
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.75
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.72
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.65
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.63
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.63
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 95.62
d1nt0a345 Mannose-binding protein associated serine protease 95.27
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.04
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.95
d1szba245 Mannose-binding protein associated serine protease 94.86
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 94.71
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 94.42
d3bpse140 Low density lipoprotein (LDL) receptor, different 94.38
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.13
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.61
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.21
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 92.52
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 92.52
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 91.63
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 90.92
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 90.58
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 90.06
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 89.94
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 89.3
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 88.84
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 88.77
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 88.55
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.45
d1ijqa250 Low density lipoprotein (LDL) receptor, different 86.38
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 85.88
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 85.12
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 84.9
d1ijqa250 Low density lipoprotein (LDL) receptor, different 84.53
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 83.84
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 82.51
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.60  E-value=5.4e-16  Score=145.88  Aligned_cols=87  Identities=32%  Similarity=0.542  Sum_probs=77.7

Q ss_pred             ccccccccceeeEEEEEEcCCCeEEEEEeccCChhHHHHHHHHHHHHHcCCCCCceeeeeEEEeCCeeEEEEEccCCCCh
Q 036131          406 YADMIGCGGSGLVYKGFLSNKTPVAVKKSKIVDQTKMDEFINELVVVSQINRRNVVRLLGCCLETQVPLLVYEFVGNGTL  485 (499)
Q Consensus       406 ~~~~lG~G~fG~Vy~g~~~~~~~vavK~~~~~~~~~~~~f~~E~~~l~~l~H~nIv~l~g~~~~~~~~~LV~Ey~~~GsL  485 (499)
                      +.+.||+|+||+||+|.+.++..||||+++.... ..++|.+|+.+|++++|||||+++|++.+.+..+|||||+++|+|
T Consensus         9 ~~~~iG~G~fg~Vy~~~~~~~~~vAvK~i~~~~~-~~~~~~~E~~~l~~l~HpnIv~~~g~~~~~~~~~lv~E~~~~g~L   87 (263)
T d1sm2a_           9 FVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAM-SEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCL   87 (263)
T ss_dssp             EEEEEECCSSCCEEEEEETTTEEEEEEECCSSSS-CHHHHHHHHHHHHHCCCTTBCCEEEEECSSSSCEEEEECCTTCBH
T ss_pred             EEEEEeeCCCeEEEEEEECCCCEEEEEEECCCcC-cHHHHHHHHHHHHhcCCCCcccccceeccCCceEEEEEecCCCcH
Confidence            4558999999999999998888999999876433 346799999999999999999999999999999999999999999


Q ss_pred             HHHHhcCC
Q 036131          486 FEQIHKKG  493 (499)
Q Consensus       486 ~~~L~~~~  493 (499)
                      .++++..+
T Consensus        88 ~~~l~~~~   95 (263)
T d1sm2a_          88 SDYLRTQR   95 (263)
T ss_dssp             HHHHHTTT
T ss_pred             HHHhhccc
Confidence            99997653
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure