BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036179
         (339 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3A2E|A Chain A, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
           Protein From Ginkgo Biloba Seeds
 pdb|3A2E|B Chain B, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
           Protein From Ginkgo Biloba Seeds
 pdb|3A2E|C Chain C, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
           Protein From Ginkgo Biloba Seeds
 pdb|3A2E|D Chain D, Crystal Structure Of Ginkbilobin-2, The Novel Antifungal
           Protein From Ginkgo Biloba Seeds
          Length = 108

 Score = 35.0 bits (79), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 170 YTLVQCIPYLSKPDCNVCLPGALAQIPACCSGKQGGRVLTPSCNIRYERYPF 221
           Y    C   +S+ DC  CL   + +I + C+   G RV    C I+YE+  F
Sbjct: 57  YGRATCKQSISQSDCTACLSNLVNRIFSICNNAIGARVQLVDCFIQYEQRSF 108


>pdb|3QWU|A Chain A, Putative Atp-Dependent Dna Ligase From Aquifex Aeolicus.
 pdb|3QWU|B Chain B, Putative Atp-Dependent Dna Ligase From Aquifex Aeolicus
          Length = 370

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 7/68 (10%)

Query: 20  CPPE---NNTAAGGLFMYKVGALFRGKLYNEAGRYL---YYNATEGVD-PNKVYGLYHCY 72
            PPE   N      LFMY+ G      LY E GR      + A E  +  +KVY  + C 
Sbjct: 250 LPPEYYTNRILRLVLFMYEEGLKTTEHLYEELGRAFIDGLFQAIEQFEKEHKVYKTFTCK 309

Query: 73  FRLQSNTI 80
           FR + N I
Sbjct: 310 FRKKENAI 317


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,300,349
Number of Sequences: 62578
Number of extensions: 345460
Number of successful extensions: 936
Number of sequences better than 100.0: 29
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 19
Number of HSP's that attempted gapping in prelim test: 925
Number of HSP's gapped (non-prelim): 29
length of query: 339
length of database: 14,973,337
effective HSP length: 99
effective length of query: 240
effective length of database: 8,778,115
effective search space: 2106747600
effective search space used: 2106747600
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)