Query         036189
Match_columns 241
No_of_seqs    151 out of 675
Neff          7.2 
Searched_HMMs 46136
Date          Fri Mar 29 10:17:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036189.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036189hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03160 uncharacterized prote 100.0 2.1E-37 4.6E-42  265.9  25.6  199    1-223     1-204 (219)
  2 PF03168 LEA_2:  Late embryogen  99.4 2.1E-12 4.5E-17   96.6  10.3   99  105-215     1-101 (101)
  3 smart00769 WHy Water Stress an  98.3 1.2E-05 2.6E-10   60.6  11.4   61   96-160    11-72  (100)
  4 PF07092 DUF1356:  Protein of u  97.5   0.012 2.6E-07   51.1  16.6   83   74-160    96-181 (238)
  5 PF12751 Vac7:  Vacuolar segreg  97.4   0.001 2.2E-08   61.3   8.9   73   53-132   307-379 (387)
  6 COG5608 LEA14-like dessication  95.4     1.2 2.6E-05   36.2  17.8  107   77-199    31-138 (161)
  7 PLN03160 uncharacterized prote  91.2     1.5 3.2E-05   37.8   8.5  102   38-152    32-146 (219)
  8 TIGR02588 conserved hypothetic  87.8     1.4 3.1E-05   34.5   5.2   48   60-113    13-62  (122)
  9 PF09307 MHC2-interact:  CLIP,   80.2    0.54 1.2E-05   36.4   0.0   36   41-77     24-59  (114)
 10 PRK10893 lipopolysaccharide ex  65.2      37  0.0008   28.5   7.6   30   75-105    37-66  (192)
 11 KOG3950 Gamma/delta sarcoglyca  64.6     9.1  0.0002   33.6   3.8   22   97-118   105-126 (292)
 12 PF09624 DUF2393:  Protein of u  64.4      34 0.00074   27.1   7.0   64   61-132    28-93  (149)
 13 PF06072 Herpes_US9:  Alphaherp  60.5     4.1 8.8E-05   27.8   0.7    8   65-72     52-59  (60)
 14 PF14155 DUF4307:  Domain of un  60.0      76  0.0016   24.3   8.6   28  127-160    71-100 (112)
 15 COG1580 FliL Flagellar basal b  59.5      27 0.00059   28.6   5.6   22   53-74     21-42  (159)
 16 PF07787 DUF1625:  Protein of u  58.2      10 0.00023   33.0   3.2   17   60-76    232-248 (248)
 17 PRK13183 psbN photosystem II r  56.9      17 0.00036   23.5   3.1   21   57-77     13-33  (46)
 18 COG3671 Predicted membrane pro  55.4     3.9 8.4E-05   31.9  -0.0   33   43-75     68-103 (125)
 19 PRK07021 fliL flagellar basal   53.8      59  0.0013   26.4   6.8   17  116-132    77-93  (162)
 20 PRK05529 cell division protein  53.3      30 0.00064   30.4   5.2   43   78-121    58-128 (255)
 21 PF12505 DUF3712:  Protein of u  53.2   1E+02  0.0022   23.7   9.5   66  136-211     3-69  (125)
 22 CHL00020 psbN photosystem II p  52.8      18  0.0004   23.0   2.7   21   56-76      9-29  (43)
 23 PF08113 CoxIIa:  Cytochrome c   52.6       6 0.00013   23.8   0.5   13   60-72     12-24  (34)
 24 PF01102 Glycophorin_A:  Glycop  50.5     6.3 0.00014   30.9   0.4   25   61-85     76-101 (122)
 25 PRK06531 yajC preprotein trans  50.2     7.3 0.00016   30.2   0.8   13   66-78     12-24  (113)
 26 PF04478 Mid2:  Mid2 like cell   48.2     3.6 7.9E-05   33.5  -1.2   42   61-119    62-103 (154)
 27 PF02468 PsbN:  Photosystem II   47.6      16 0.00034   23.4   1.8   18   59-76     12-29  (43)
 28 PF14927 Neurensin:  Neurensin   47.4      48  0.0011   26.6   5.1   12   60-71     54-65  (140)
 29 KOG0810 SNARE protein Syntaxin  44.6     7.6 0.00016   35.1   0.1   14   37-50    263-276 (297)
 30 COG4698 Uncharacterized protei  42.8      23  0.0005   29.7   2.7   30   66-95     26-58  (197)
 31 PF02009 Rifin_STEVOR:  Rifin/s  42.3     9.6 0.00021   34.5   0.4   17   59-75    264-280 (299)
 32 PF11322 DUF3124:  Protein of u  41.4 1.7E+02  0.0037   23.1   7.2   53   96-154    19-73  (125)
 33 PF04790 Sarcoglycan_1:  Sarcog  40.9 2.6E+02  0.0056   24.8  11.6   17   98-114    84-100 (264)
 34 PF06637 PV-1:  PV-1 protein (P  40.7      36 0.00079   31.8   3.8   12   60-71     38-49  (442)
 35 PHA02844 putative transmembran  39.9      30 0.00065   24.7   2.5   11   62-72     59-69  (75)
 36 PF14283 DUF4366:  Domain of un  38.3      32  0.0007   29.7   3.0   21   61-81    170-190 (218)
 37 PF13131 DUF3951:  Protein of u  36.7      25 0.00054   23.2   1.6   31   50-80      3-34  (53)
 38 PF11906 DUF3426:  Protein of u  36.5   2E+02  0.0044   22.4   7.3   57   81-141    48-106 (149)
 39 PRK08455 fliL flagellar basal   36.1      52  0.0011   27.5   3.8   15  118-132   103-117 (182)
 40 PF04573 SPC22:  Signal peptida  35.9 2.4E+02  0.0052   23.4   7.8   32   97-132    65-97  (175)
 41 PF06024 DUF912:  Nucleopolyhed  35.6      48   0.001   24.9   3.2   14   63-76     75-89  (101)
 42 PF10907 DUF2749:  Protein of u  35.3      51  0.0011   22.9   3.0   16   62-77     13-28  (66)
 43 PF03302 VSP:  Giardia variant-  33.8      14 0.00031   34.6   0.1   34   43-77    362-396 (397)
 44 PF09911 DUF2140:  Uncharacteri  33.3      69  0.0015   26.8   4.2   20   60-79     12-31  (187)
 45 PF15012 DUF4519:  Domain of un  33.3      36 0.00078   23.0   1.9   15   63-77     42-56  (56)
 46 PF09865 DUF2092:  Predicted pe  33.0   3E+02  0.0065   23.6   8.1   36   96-132    35-72  (214)
 47 PF06092 DUF943:  Enterobacteri  32.9      28  0.0006   28.5   1.6   16   61-76     13-28  (157)
 48 PTZ00116 signal peptidase; Pro  32.5 2.8E+02  0.0061   23.4   7.6   52   76-131    36-94  (185)
 49 PF12505 DUF3712:  Protein of u  32.0 1.1E+02  0.0023   23.5   4.8   27   98-125    98-124 (125)
 50 PHA02650 hypothetical protein;  31.9      30 0.00065   25.0   1.5   11   62-72     60-70  (81)
 51 PF05478 Prominin:  Prominin;    31.9      44 0.00096   34.3   3.3   27   41-67    133-159 (806)
 52 PF11395 DUF2873:  Protein of u  31.2      22 0.00048   21.9   0.6    9   66-74     24-32  (43)
 53 PF15145 DUF4577:  Domain of un  30.4      46   0.001   25.7   2.4   26   49-76     63-88  (128)
 54 PF02038 ATP1G1_PLM_MAT8:  ATP1  30.1      71  0.0015   21.0   2.9   16   53-68     18-33  (50)
 55 TIGR01477 RIFIN variant surfac  29.9      20 0.00044   33.1   0.4   24   53-76    312-335 (353)
 56 PTZ00046 rifin; Provisional     28.9      22 0.00047   33.0   0.4   24   53-76    317-340 (358)
 57 PRK05696 fliL flagellar basal   27.8 1.5E+02  0.0032   24.2   5.2   17  116-132    85-101 (170)
 58 PF04505 Dispanin:  Interferon-  27.7 1.3E+02  0.0028   21.6   4.3    8   63-70     33-40  (82)
 59 PRK12785 fliL flagellar basal   27.7 1.5E+02  0.0033   24.2   5.2   16  117-132    86-101 (166)
 60 COG5009 MrcA Membrane carboxyp  27.6      29 0.00063   35.3   1.1   31   52-82      8-38  (797)
 61 PHA03093 EEV glycoprotein; Pro  27.0      40 0.00087   28.3   1.6   21  109-130    97-117 (185)
 62 PF10614 CsgF:  Type VIII secre  26.9      44 0.00096   26.9   1.8   11   71-81     23-33  (142)
 63 PF13396 PLDc_N:  Phospholipase  24.8      84  0.0018   19.5   2.6   16   62-77     31-46  (46)
 64 PHA02673 ORF109 EEV glycoprote  24.4      28 0.00061   28.5   0.3    8  115-122    78-85  (161)
 65 PF15050 SCIMP:  SCIMP protein   23.7      31 0.00068   27.0   0.4   10   66-75     23-32  (133)
 66 PF04790 Sarcoglycan_1:  Sarcog  23.6      95  0.0021   27.6   3.5   11  211-222   199-209 (264)
 67 PF06835 LptC:  Lipopolysacchar  23.5      78  0.0017   25.0   2.8   51   78-130    32-82  (176)
 68 PF05545 FixQ:  Cbb3-type cytoc  23.2      48   0.001   21.2   1.2   13   66-78     22-34  (49)
 69 COG4736 CcoQ Cbb3-type cytochr  23.0      49  0.0011   22.7   1.2   13   66-78     22-34  (60)
 70 PF01034 Syndecan:  Syndecan do  22.9      28  0.0006   24.2   0.0   15   62-76     22-36  (64)
 71 COG1589 FtsQ Cell division sep  22.9 1.2E+02  0.0026   26.7   4.0   30   61-90     40-69  (269)
 72 PF12321 DUF3634:  Protein of u  22.8      32 0.00068   26.4   0.3   17   67-83     10-28  (108)
 73 PTZ00382 Variant-specific surf  22.8      55  0.0012   24.4   1.6   15   61-75     78-93  (96)
 74 PRK14759 potassium-transportin  22.7      41 0.00089   19.6   0.7   19   60-78     10-28  (29)
 75 PF08693 SKG6:  Transmembrane a  22.3      74  0.0016   20.0   1.8   11   66-76     28-38  (40)
 76 PF13473 Cupredoxin_1:  Cupredo  22.1      66  0.0014   23.7   1.9   35   80-114    19-55  (104)
 77 PHA03049 IMV membrane protein;  21.9      36 0.00077   23.8   0.4   17   60-76      9-25  (68)
 78 PF13800 Sigma_reg_N:  Sigma fa  21.7      33 0.00072   25.2   0.2   12  104-115    56-67  (96)
 79 PF05961 Chordopox_A13L:  Chord  21.4      40 0.00086   23.6   0.5   17   60-76      9-25  (68)
 80 PF00927 Transglut_C:  Transglu  21.2 3.3E+02  0.0071   19.9   5.6   61   97-160    12-76  (107)
 81 PF15018 InaF-motif:  TRP-inter  21.1 1.4E+02   0.003   18.5   2.8   20   60-79     17-37  (38)
 82 COG5294 Uncharacterized protei  20.9 2.5E+02  0.0054   21.7   4.8   13  101-113    53-65  (113)
 83 COG2332 CcmE Cytochrome c-type  20.9 3.3E+02  0.0072   22.2   5.7   32  101-132    71-102 (153)
 84 PHA03265 envelope glycoprotein  20.5      58  0.0013   30.2   1.5   23   47-71    350-372 (402)
 85 PF01299 Lamp:  Lysosome-associ  20.5      81  0.0017   28.3   2.5   18   61-78    282-299 (306)
 86 PF02158 Neuregulin:  Neureguli  20.5      35 0.00077   31.9   0.1   23   48-72      9-32  (404)
 87 PF14828 Amnionless:  Amnionles  20.4      61  0.0013   30.9   1.8   21   61-81    349-369 (437)
 88 PF09049 SNN_transmemb:  Stanni  20.3 1.2E+02  0.0025   17.9   2.2   16   52-67     14-29  (33)

No 1  
>PLN03160 uncharacterized protein; Provisional
Probab=100.00  E-value=2.1e-37  Score=265.86  Aligned_cols=199  Identities=13%  Similarity=0.139  Sum_probs=159.6

Q ss_pred             CccccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCchhhhHHHHHHHHHHHHHHHHHhheeeEEecCCCCE
Q 036189            1 MEENEIIQNSAHRCPSKVYPLTTGDISQLPPSRPPHYQHFQIKKLPKLIIITLLVVAASISLTALICILMYFTLGPKLPS   80 (241)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~p~~~~~~~~~~~rc~~~~~~~~~~~i~llgl~~lil~lv~rPk~P~   80 (241)
                      |-|+||+||+|-.+++.     .+|.++.    .+++++.+|++|++||+|++.++   ++++++++.++|++||||+|+
T Consensus         1 ~~~~~~~~p~a~~~~~~-----~~d~~~~----~~~~~~~~r~~~~~c~~~~~a~~---l~l~~v~~~l~~~vfrPk~P~   68 (219)
T PLN03160          1 MAETEQVRPLAPAAFRL-----RSDEEEA----TNHLKKTRRRNCIKCCGCITATL---LILATTILVLVFTVFRVKDPV   68 (219)
T ss_pred             CCccccCCCCCCCcccc-----cCchhhc----CcchhccccccceEEHHHHHHHH---HHHHHHHHheeeEEEEccCCe
Confidence            89999999999988872     1222221    12222234555666655444333   355677788889999999999


Q ss_pred             EEEeeEEEeeeecCC-----CceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcccceeeeccCCCceecCCCeEEEE
Q 036189           81 LHLDTFSVSNFTIGS-----TNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVSPPFKVKPMKKSTIH  155 (241)
Q Consensus        81 f~V~s~~l~~f~~~~-----~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg~~~vp~F~q~~~~tt~v~  155 (241)
                      |+|++++|++|+++.     ..+|++++++++++|||+ ++|+|+++++.++|+|+.   +|++.+|+|+|++++++.++
T Consensus        69 ~~v~~v~l~~~~~~~~~~~~~~~n~tl~~~v~v~NPN~-~~~~Y~~~~~~v~Y~g~~---vG~a~~p~g~~~ar~T~~l~  144 (219)
T PLN03160         69 IKMNGVTVTKLELINNTTLRPGTNITLIADVSVKNPNV-ASFKYSNTTTTIYYGGTV---VGEARTPPGKAKARRTMRMN  144 (219)
T ss_pred             EEEEEEEEeeeeeccCCCCceeEEEEEEEEEEEECCCc-eeEEEcCeEEEEEECCEE---EEEEEcCCcccCCCCeEEEE
Confidence            999999999999864     357888889999999999 899999999999999999   99999999999999999999


Q ss_pred             EEEEeCCceeecCHHHHHHHHHHhhCCceEEEEEEEEEEEEEEEEeceEEEeeeeEEEEecceEEeee
Q 036189          156 VQLATGDSLIFLNHQLLQKINSQRRNGRMVVFGLAVRAKTRFTGVSWLWWTEFANLMYTCLDLKVGFK  223 (241)
Q Consensus       156 v~l~~~~~~~~l~~~~~~~l~~d~~~G~~v~~~v~v~~~vr~kv~~g~~~~~~~~~~v~C~~l~V~~~  223 (241)
                      +++.. .....+..   ..|..|..+|. ++|++++++++++++  |+++++++.++++| +++|++.
T Consensus       145 ~tv~~-~~~~~~~~---~~L~~D~~~G~-v~l~~~~~v~gkVkv--~~i~k~~v~~~v~C-~v~V~~~  204 (219)
T PLN03160        145 VTVDI-IPDKILSV---PGLLTDISSGL-LNMNSYTRIGGKVKI--LKIIKKHVVVKMNC-TMTVNIT  204 (219)
T ss_pred             EEEEE-Eeceeccc---hhHHHHhhCCe-EEEEEEEEEEEEEEE--EEEEEEEEEEEEEe-EEEEECC
Confidence            99765 21122221   46888999999 999999999999999  99999999999999 9999883


No 2  
>PF03168 LEA_2:  Late embryogenesis abundant protein;  InterPro: IPR004864 Different types of LEA proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress [, ]. The function of these proteins is unknown. ; PDB: 3BUT_A 1XO8_A 1YYC_A.
Probab=99.41  E-value=2.1e-12  Score=96.59  Aligned_cols=99  Identities=20%  Similarity=0.332  Sum_probs=72.8

Q ss_pred             EEEEeCCCCeeEEEEccEEEEEEeCCcccceee-eccCCCceecCCCeEEEEEEEEeCCceeecCHHHHHHHHHHhhCCc
Q 036189          105 NLTFKNPDHLWQIYLDYIECIALNHDHFPIAIN-HSVSPPFKVKPMKKSTIHVQLATGDSLIFLNHQLLQKINSQRRNGR  183 (241)
Q Consensus       105 ~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg-~~~vp~F~q~~~~tt~v~v~l~~~~~~~~l~~~~~~~l~~d~~~G~  183 (241)
                      +|+++|||. ++++|+++++.++|+|+.   +| ....++|+|++++++.+.+.+....      ..+.+.+.++. .|.
T Consensus         1 ~l~v~NPN~-~~i~~~~~~~~v~~~g~~---v~~~~~~~~~~i~~~~~~~v~~~v~~~~------~~l~~~l~~~~-~~~   69 (101)
T PF03168_consen    1 TLSVRNPNS-FGIRYDSIEYDVYYNGQR---VGTGGSLPPFTIPARSSTTVPVPVSVDY------SDLPRLLKDLL-AGR   69 (101)
T ss_dssp             EEEEEESSS-S-EEEEEEEEEEEESSSE---EEEEEECE-EEESSSCEEEEEEEEEEEH------HHHHHHHHHHH-HTT
T ss_pred             CEEEECCCc-eeEEEeCEEEEEEECCEE---EECccccCCeEECCCCcEEEEEEEEEcH------HHHHHHHHhhh-ccc
Confidence            589999999 999999999999999998   99 7789999999999999988877721      22245666666 556


Q ss_pred             eEEEEEEEEEEEEEEE-EeceEEEeeeeEEEEe
Q 036189          184 MVVFGLAVRAKTRFTG-VSWLWWTEFANLMYTC  215 (241)
Q Consensus       184 ~v~~~v~v~~~vr~kv-~~g~~~~~~~~~~v~C  215 (241)
                       ..+++.+++++++++ ..+.+.+.++.++.+|
T Consensus        70 -~~~~v~~~~~g~~~v~~~~~~~~~~v~~~~~~  101 (101)
T PF03168_consen   70 -VPFDVTYRIRGTFKVLGTPIFGSVRVPVSCEC  101 (101)
T ss_dssp             -SCEEEEEEEEEEEE-EE-TTTSCEEEEEEEEE
T ss_pred             -cceEEEEEEEEEEEEcccceeeeEEEeEEeEC
Confidence             677777888888883 2244454555555554


No 3  
>smart00769 WHy Water Stress and Hypersensitive response.
Probab=98.33  E-value=1.2e-05  Score=60.63  Aligned_cols=61  Identities=10%  Similarity=0.132  Sum_probs=56.3

Q ss_pred             CceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcccceeeeccCC-CceecCCCeEEEEEEEEe
Q 036189           96 TNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVSP-PFKVKPMKKSTIHVQLAT  160 (241)
Q Consensus        96 ~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg~~~vp-~F~q~~~~tt~v~v~l~~  160 (241)
                      +.++.++.+++.+.|||. ..+.|+.++..++|+|..   +|++..+ ++..++++++.+.+.+..
T Consensus        11 ~~~~~~~~l~l~v~NPN~-~~l~~~~~~y~l~~~g~~---v~~g~~~~~~~ipa~~~~~v~v~~~~   72 (100)
T smart00769       11 SGLEIEIVLKVKVQNPNP-FPIPVNGLSYDLYLNGVE---LGSGEIPDSGTLPGNGRTVLDVPVTV   72 (100)
T ss_pred             cceEEEEEEEEEEECCCC-CccccccEEEEEEECCEE---EEEEEcCCCcEECCCCcEEEEEEEEe
Confidence            367789999999999998 999999999999999999   9999986 799999999999888877


No 4  
>PF07092 DUF1356:  Protein of unknown function (DUF1356);  InterPro: IPR009790 This family consists of several hypothetical mammalian proteins of around 250 residues in length. The function of this family is unknown.
Probab=97.49  E-value=0.012  Score=51.12  Aligned_cols=83  Identities=11%  Similarity=0.178  Sum_probs=58.5

Q ss_pred             ecCCCCEEEEeeEEEee--eecCCCceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcccceeeeccCCC-ceecCCC
Q 036189           74 LGPKLPSLHLDTFSVSN--FTIGSTNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVSPP-FKVKPMK  150 (241)
Q Consensus        74 ~rPk~P~f~V~s~~l~~--f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg~~~vp~-F~q~~~~  150 (241)
                      +-||.-.++-.++....  |+-+.+.+..+++-.+.++|||- ..+.-.++.+.+.|...-   +|.+.... ...++++
T Consensus        96 LfPRsV~v~~~gv~s~~V~f~~~~~~v~l~itn~lNIsN~NF-y~V~Vt~~s~qv~~~~~V---VG~~~~~~~~~I~Prs  171 (238)
T PF07092_consen   96 LFPRSVTVSPVGVKSVTVSFNPDKSTVQLNITNTLNISNPNF-YPVTVTNLSIQVLYMKTV---VGKGKNSNITVIGPRS  171 (238)
T ss_pred             EeCcEEEEecCcEEEEEEEEeCCCCEEEEEEEEEEEccCCCE-EEEEEEeEEEEEEEEEeE---EeeeEecceEEecccC
Confidence            34664444333322222  33333568889999999999996 999999999999998877   99887654 4677777


Q ss_pred             eEEEEEEEEe
Q 036189          151 KSTIHVQLAT  160 (241)
Q Consensus       151 tt~v~v~l~~  160 (241)
                      .+.+..++..
T Consensus       172 ~~q~~~tV~t  181 (238)
T PF07092_consen  172 SKQVNYTVKT  181 (238)
T ss_pred             CceEEEEeeE
Confidence            7777666555


No 5  
>PF12751 Vac7:  Vacuolar segregation subunit 7;  InterPro: IPR024260 Vac7 is localised at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance []. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway []. The Fab1 lipid pathway is important for correct regulation of membrane trafficking events.
Probab=97.36  E-value=0.001  Score=61.26  Aligned_cols=73  Identities=14%  Similarity=0.238  Sum_probs=44.8

Q ss_pred             HHHHHHHHHHHHHHhheeeEEecCCCCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcc
Q 036189           53 LLVVAASISLTALICILMYFTLGPKLPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHF  132 (241)
Q Consensus        53 ~~~~~~~i~llgl~~lil~lv~rPk~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~  132 (241)
                      ++.+++++++.|++.++|. .-+|   --.|+=..|.+.-.+  .--.-|+++|.+.|||. +.|.-++.++.++-+-..
T Consensus       307 ~~~i~~lL~ig~~~gFv~A-ttKp---L~~v~v~~I~NVlaS--~qELmfdl~V~A~NPn~-~~V~I~d~dldIFAKS~y  379 (387)
T PF12751_consen  307 YLSILLLLVIGFAIGFVFA-TTKP---LTDVQVVSIQNVLAS--EQELMFDLTVEAFNPNW-FTVTIDDMDLDIFAKSRY  379 (387)
T ss_pred             HHHHHHHHHHHHHHHhhhh-cCcc---cccceEEEeeeeeec--cceEEEeeEEEEECCCe-EEEEeccceeeeEecCCc
Confidence            3343333444444554444 3333   333333444443333  34466889999999998 999999999999876554


No 6  
>COG5608 LEA14-like dessication related protein [Defense mechanisms]
Probab=95.37  E-value=1.2  Score=36.21  Aligned_cols=107  Identities=19%  Similarity=0.159  Sum_probs=73.6

Q ss_pred             CCCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcccceeeeccC-CCceecCCCeEEEE
Q 036189           77 KLPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVS-PPFKVKPMKKSTIH  155 (241)
Q Consensus        77 k~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg~~~v-p~F~q~~~~tt~v~  155 (241)
                      +.|...--.+..-...    ...-.+-.++.++|||. ..+--..++..+|-+|-.   +|.+.. .++..++++...+.
T Consensus        31 ~~p~ve~~ka~wGkvt----~s~~EiV~t~KiyNPN~-fPipVtgl~y~vymN~Ik---i~eG~~~k~~~v~p~S~~tvd  102 (161)
T COG5608          31 KKPGVESMKAKWGKVT----NSETEIVGTLKIYNPNP-FPIPVTGLQYAVYMNDIK---IGEGEILKGTTVPPNSRETVD  102 (161)
T ss_pred             CCCCceEEEEEEEEEe----ccceEEEEEEEecCCCC-cceeeeceEEEEEEcceE---eeccccccceEECCCCeEEEE
Confidence            4455555555554432    24457888999999998 999999999999999988   999875 56999999999998


Q ss_pred             EEEEeCCceeecCHHHHHHHHHHhhCCceEEEEEEEEEEEEEEE
Q 036189          156 VQLATGDSLIFLNHQLLQKINSQRRNGRMVVFGLAVRAKTRFTG  199 (241)
Q Consensus       156 v~l~~~~~~~~l~~~~~~~l~~d~~~G~~v~~~v~v~~~vr~kv  199 (241)
                      +.+.. +     .+..-+.......+|.+-.+++++  +..+++
T Consensus       103 v~l~~-d-----~~~~ke~w~~hi~ngErs~Ir~~i--~~~v~v  138 (161)
T COG5608         103 VPLRL-D-----NSKIKEWWVTHIENGERSTIRVRI--KGVVKV  138 (161)
T ss_pred             EEEEE-e-----hHHHHHHHHHHhhccCcccEEEEE--EEEEEE
Confidence            88877 2     222334455556677632333333  334455


No 7  
>PLN03160 uncharacterized protein; Provisional
Probab=91.17  E-value=1.5  Score=37.80  Aligned_cols=102  Identities=11%  Similarity=0.073  Sum_probs=52.4

Q ss_pred             CCCCCCCchhhhHHHHHHHHHHHHHHHHHhheeeEEecCC--CCEEEEeeEEEe-------eeecCC----CceeEEEEE
Q 036189           38 QHFQIKKLPKLIIITLLVVAASISLTALICILMYFTLGPK--LPSLHLDTFSVS-------NFTIGS----TNLIAKWDF  104 (241)
Q Consensus        38 ~~~~~~~~~rc~~~~~~~~~~~i~llgl~~lil~lv~rPk--~P~f~V~s~~l~-------~f~~~~----~~l~~~~~~  104 (241)
                      +|+++.+||.|++..+++++   +++++++++++=.=+|+  .-.++|+++.+.       .+|++-    ..-|.|. +
T Consensus        32 ~r~~~~~c~~~~~a~~l~l~---~v~~~l~~~vfrPk~P~~~v~~v~l~~~~~~~~~~~~~~~n~tl~~~v~v~NPN~-~  107 (219)
T PLN03160         32 RRRNCIKCCGCITATLLILA---TTILVLVFTVFRVKDPVIKMNGVTVTKLELINNTTLRPGTNITLIADVSVKNPNV-A  107 (219)
T ss_pred             ccccceEEHHHHHHHHHHHH---HHHHheeeEEEEccCCeEEEEEEEEeeeeeccCCCCceeEEEEEEEEEEEECCCc-e
Confidence            45667778888887776664   23333344444345553  345666666553       233321    1123444 3


Q ss_pred             EEEEeCCCCeeEEEEccEEEEEEeCCcccceeeeccCCCceecCCCeE
Q 036189          105 NLTFKNPDHLWQIYLDYIECIALNHDHFPIAINHSVSPPFKVKPMKKS  152 (241)
Q Consensus       105 ~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~~~~lg~~~vp~F~q~~~~tt  152 (241)
                      .+.-.  |..+.++|+...+.-.    .   +..+.++++.+..-+.+
T Consensus       108 ~~~Y~--~~~~~v~Y~g~~vG~a----~---~p~g~~~ar~T~~l~~t  146 (219)
T PLN03160        108 SFKYS--NTTTTIYYGGTVVGEA----R---TPPGKAKARRTMRMNVT  146 (219)
T ss_pred             eEEEc--CeEEEEEECCEEEEEE----E---cCCcccCCCCeEEEEEE
Confidence            44443  4458889977654321    2   33344455555555544


No 8  
>TIGR02588 conserved hypothetical protein TIGR02588. The function of this protein is unknown. It is always found as part of a two-gene operon with TIGR02587, a protein that appears to span the membrane seven times. It is found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Sinorhizobium meliloti, and Gloeobacter violaceus, so far, all of which are bacterial.
Probab=87.79  E-value=1.4  Score=34.48  Aligned_cols=48  Identities=15%  Similarity=0.241  Sum_probs=32.2

Q ss_pred             HHHHHHHhheee--EEecCCCCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCC
Q 036189           60 ISLTALICILMY--FTLGPKLPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDH  113 (241)
Q Consensus        60 i~llgl~~lil~--lv~rPk~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~  113 (241)
                      +++++++.+++|  +.-+++.|.+.+......+      .....+-+-++++|--.
T Consensus        13 ~ill~viglv~y~~l~~~~~pp~l~v~~~~~~r------~~~gqyyVpF~V~N~gg   62 (122)
T TIGR02588        13 LILAAMFGLVAYDWLRYSNKAAVLEVAPAEVER------MQTGQYYVPFAIHNLGG   62 (122)
T ss_pred             HHHHHHHHHHHHHhhccCCCCCeEEEeehheeE------EeCCEEEEEEEEEeCCC
Confidence            456666667775  5566788999888877655      23345667777777654


No 9  
>PF09307 MHC2-interact:  CLIP, MHC2 interacting;  InterPro: IPR015386 This domain is found in MHC class II-associated invariant chain (Ii), and in class II invariant chain-associated peptide (CLIP), and is required for association with class II major histocompatibility complex (MHC II) in the MHC II processing pathway []. Ii plays a critical role in the assembly of the MHC, as well as in MHC II antigen processing by stabilising peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place []. In antigen-presenting cells (APCs), loading of MHC II molecules with peptides is regulated by Ii, which blocks MHC II antigen-binding sites in pre-endosomal compartments []. Several factors modulate the surface expression of MHC II molecules via post-Golgi mechanisms, including CLIP. The Invariant chain contains a single transmembrane domain. Ii first assembles into a trimer and then associates with three class II alpha/beta MHC heterodimers. Although the membrane-proximal region of the Ii luminal domain is structurally disordered, the C-terminal segment of the luminal domain is largely alpha-helical and contains a major interaction site for the Ii trimer []. More information about these proteins can be found at Protein of the Month: MHC [].; GO: 0042289 MHC class II protein binding, 0006886 intracellular protein transport, 0006955 immune response, 0019882 antigen processing and presentation, 0016020 membrane; PDB: 1A6A_C 3QXD_F 3QXA_F 3PDO_C 1MUJ_C 3PGD_F 3PGC_F.
Probab=80.18  E-value=0.54  Score=36.39  Aligned_cols=36  Identities=19%  Similarity=0.296  Sum_probs=0.0

Q ss_pred             CCCCchhhhHHHHHHHHHHHHHHHHHhheeeEEecCC
Q 036189           41 QIKKLPKLIIITLLVVAASISLTALICILMYFTLGPK   77 (241)
Q Consensus        41 ~~~~~~rc~~~~~~~~~~~i~llgl~~lil~lv~rPk   77 (241)
                      +|.+|.|++.++.+.+++.++|+|- ++..|++|.=+
T Consensus        24 ~~~s~sra~~vagltvLa~LLiAGQ-a~TaYfv~~Qk   59 (114)
T PF09307_consen   24 QRGSCSRALKVAGLTVLACLLIAGQ-AVTAYFVFQQK   59 (114)
T ss_dssp             -------------------------------------
T ss_pred             CCCCccchhHHHHHHHHHHHHHHhH-HHHHHHHHHhH
Confidence            4567889999888777766777775 45556666653


No 10 
>PRK10893 lipopolysaccharide exporter periplasmic protein; Provisional
Probab=65.16  E-value=37  Score=28.54  Aligned_cols=30  Identities=10%  Similarity=0.008  Sum_probs=22.7

Q ss_pred             cCCCCEEEEeeEEEeeeecCCCceeEEEEEE
Q 036189           75 GPKLPSLHLDTFSVSNFTIGSTNLIAKWDFN  105 (241)
Q Consensus        75 rPk~P~f~V~s~~l~~f~~~~~~l~~~~~~~  105 (241)
                      .++.|.|.+++++...|+.++ .+++.++..
T Consensus        37 ~~~~Pdy~~~~~~~~~yd~~G-~l~y~l~a~   66 (192)
T PRK10893         37 NNNDPTYQSQHTDTVVYNPEG-ALSYKLVAQ   66 (192)
T ss_pred             CCCCCCEEEeccEEEEECCCC-CEEEEEEec
Confidence            356799999999999999875 555555443


No 11 
>KOG3950 consensus Gamma/delta sarcoglycan [Cytoskeleton]
Probab=64.57  E-value=9.1  Score=33.61  Aligned_cols=22  Identities=14%  Similarity=0.102  Sum_probs=16.4

Q ss_pred             ceeEEEEEEEEEeCCCCeeEEE
Q 036189           97 NLIAKWDFNLTFKNPDHLWQIY  118 (241)
Q Consensus        97 ~l~~~~~~~l~v~NPN~k~~i~  118 (241)
                      .+...=++++.++|||.++.=+
T Consensus       105 ~~~S~rnvtvnarn~~g~v~~~  126 (292)
T KOG3950|consen  105 YLQSARNVTVNARNPNGKVTGQ  126 (292)
T ss_pred             EEEeccCeeEEccCCCCceeee
Confidence            3455667899999999887533


No 12 
>PF09624 DUF2393:  Protein of unknown function (DUF2393);  InterPro: IPR013417  The function of this protein is unknown. It is always found as part of a two-gene operon with IPR013416 from INTERPRO, a protein that appears to span the membrane seven times. It has so far been found in the bacteria Anabaena sp. (strain PCC 7120), Agrobacterium tumefaciens, Rhizobium meliloti, and Gloeobacter violaceus.
Probab=64.44  E-value=34  Score=27.14  Aligned_cols=64  Identities=20%  Similarity=0.177  Sum_probs=39.4

Q ss_pred             HHHHHHhheeeEEecC--CCCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCCcc
Q 036189           61 SLTALICILMYFTLGP--KLPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHDHF  132 (241)
Q Consensus        61 ~llgl~~lil~lv~rP--k~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~  132 (241)
                      +++.++.+++|.++..  +.+..++.+.+-  ++.+     -.+.+..+++|-.+ ..+..=.+++.+...+..
T Consensus        28 i~~~~~~~~~~~~l~~~~~~~~~~~~~~~~--l~~~-----~~~~v~g~V~N~g~-~~i~~c~i~~~l~~~~~~   93 (149)
T PF09624_consen   28 ILAFLIPFFGYYWLDKYLKKIELTLTSQKR--LQYS-----ESFYVDGTVTNTGK-FTIKKCKITVKLYNDKQV   93 (149)
T ss_pred             HHHHHHHHHHHHHHhhhcCCceEEEeeeee--eeec-----cEEEEEEEEEECCC-CEeeEEEEEEEEEeCCCc
Confidence            3333445555554444  445665555443  3333     46777899999887 777777788888885543


No 13 
>PF06072 Herpes_US9:  Alphaherpesvirus tegument protein US9;  InterPro: IPR009278 This family consists of several US9 and related proteins from the Alphaherpesviruses. The function of the US9 protein is unknown although in Bovine herpesvirus 5 Us9 is essential for the anterograde spread of the virus from the olfactory mucosa to the bulb [].; GO: 0019033 viral tegument
Probab=60.47  E-value=4.1  Score=27.80  Aligned_cols=8  Identities=13%  Similarity=0.330  Sum_probs=3.5

Q ss_pred             HHhheeeE
Q 036189           65 LICILMYF   72 (241)
Q Consensus        65 l~~lil~l   72 (241)
                      +-+++.|+
T Consensus        52 lG~~~~~~   59 (60)
T PF06072_consen   52 LGALVAWH   59 (60)
T ss_pred             HHHHhhcc
Confidence            34444443


No 14 
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=60.00  E-value=76  Score=24.25  Aligned_cols=28  Identities=14%  Similarity=0.210  Sum_probs=16.7

Q ss_pred             EeCCcccceeee--ccCCCceecCCCeEEEEEEEEe
Q 036189          127 LNHDHFPIAINH--SVSPPFKVKPMKKSTIHVQLAT  160 (241)
Q Consensus       127 ~Y~g~~~~~lg~--~~vp~F~q~~~~tt~v~v~l~~  160 (241)
                      .|.+..   +|.  ..+|+   +...+..+.+++..
T Consensus        71 ~~d~ae---VGrreV~vp~---~~~~~~~~~v~v~T  100 (112)
T PF14155_consen   71 DYDGAE---VGRREVLVPP---SGERTVRVTVTVRT  100 (112)
T ss_pred             eCCCCE---EEEEEEEECC---CCCcEEEEEEEEEe
Confidence            345554   773  45677   55556666666665


No 15 
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion]
Probab=59.50  E-value=27  Score=28.60  Aligned_cols=22  Identities=23%  Similarity=0.240  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHhheeeEEe
Q 036189           53 LLVVAASISLTALICILMYFTL   74 (241)
Q Consensus        53 ~~~~~~~i~llgl~~lil~lv~   74 (241)
                      ++++++.++++++.+..+|+..
T Consensus        21 ~liv~ivl~~~a~~~~~~~~~~   42 (159)
T COG1580          21 LLIVLIVLLALAGAGYFFWFGS   42 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhc
Confidence            3344434566666777777765


No 16 
>PF07787 DUF1625:  Protein of unknown function (DUF1625);  InterPro: IPR012430 Sequences making up this family are derived from hypothetical proteins expressed by both prokaryotic and eukaryotic species. The region in question is approximately 250 residues long. 
Probab=58.16  E-value=10  Score=32.97  Aligned_cols=17  Identities=29%  Similarity=0.448  Sum_probs=12.3

Q ss_pred             HHHHHHHhheeeEEecC
Q 036189           60 ISLTALICILMYFTLGP   76 (241)
Q Consensus        60 i~llgl~~lil~lv~rP   76 (241)
                      +.+..+++.+.|+.|||
T Consensus       232 ~~lsl~~Ia~aW~~yRP  248 (248)
T PF07787_consen  232 FSLSLLTIALAWLFYRP  248 (248)
T ss_pred             HHHHHHHHHHhheeeCc
Confidence            34445577788999998


No 17 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=56.89  E-value=17  Score=23.52  Aligned_cols=21  Identities=29%  Similarity=0.358  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHhheeeEEecCC
Q 036189           57 AASISLTALICILMYFTLGPK   77 (241)
Q Consensus        57 ~~~i~llgl~~lil~lv~rPk   77 (241)
                      ++..++++++...+|..|-|.
T Consensus        13 ~i~~lL~~~TgyaiYtaFGpp   33 (46)
T PRK13183         13 TILAILLALTGFGIYTAFGPP   33 (46)
T ss_pred             HHHHHHHHHhhheeeeccCCc
Confidence            334578999999999999983


No 18 
>COG3671 Predicted membrane protein [Function unknown]
Probab=55.43  E-value=3.9  Score=31.88  Aligned_cols=33  Identities=0%  Similarity=0.064  Sum_probs=19.3

Q ss_pred             CCchhhhHHHHHHHHHHHHHHHHHh---heeeEEec
Q 036189           43 KKLPKLIIITLLVVAASISLTALIC---ILMYFTLG   75 (241)
Q Consensus        43 ~~~~rc~~~~~~~~~~~i~llgl~~---lil~lv~r   75 (241)
                      +.+++|+++.++++++.++.+|+++   +-+|.++|
T Consensus        68 RTFw~~vl~~iIg~Llt~lgiGv~i~~AlgvW~i~R  103 (125)
T COG3671          68 RTFWLAVLWWIIGLLLTFLGIGVVILVALGVWYIYR  103 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4567777777777765555556533   33455554


No 19 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=53.82  E-value=59  Score=26.36  Aligned_cols=17  Identities=12%  Similarity=-0.089  Sum_probs=10.6

Q ss_pred             EEEEccEEEEEEeCCcc
Q 036189          116 QIYLDYIECIALNHDHF  132 (241)
Q Consensus       116 ~i~Y~~~~v~v~Y~g~~  132 (241)
                      +-+|=..++++.+.+..
T Consensus        77 ~~rylkv~i~L~~~~~~   93 (162)
T PRK07021         77 ADRVLYVGLTLRLPDEA   93 (162)
T ss_pred             CceEEEEEEEEEECCHH
Confidence            35676677777666543


No 20 
>PRK05529 cell division protein FtsQ; Provisional
Probab=53.32  E-value=30  Score=30.38  Aligned_cols=43  Identities=14%  Similarity=0.094  Sum_probs=27.8

Q ss_pred             CCEEEEeeEEEeeeecCC--------------CceeE--------------EEEEEEEEeCCCCeeEEEEcc
Q 036189           78 LPSLHLDTFSVSNFTIGS--------------TNLIA--------------KWDFNLTFKNPDHLWQIYLDY  121 (241)
Q Consensus        78 ~P~f~V~s~~l~~f~~~~--------------~~l~~--------------~~~~~l~v~NPN~k~~i~Y~~  121 (241)
                      .|.|.|.++.|++-..-+              +.+..              -=++.++-+.||. +.|.-.+
T Consensus        58 Sp~~~v~~I~V~Gn~~vs~~eI~~~~~~~~g~~l~~vd~~~~~~~l~~~P~V~sa~V~r~~P~t-l~I~V~E  128 (255)
T PRK05529         58 SPLLALRSIEVAGNMRVKPQDIVAALRDQFGKPLPLVDPETVRKKLAAFPLIRSYSVESKPPGT-IVVRVVE  128 (255)
T ss_pred             CCceEEEEEEEECCccCCHHHHHHHhcccCCCcceeECHHHHHHHHhcCCCEeEEEEEEeCCCE-EEEEEEE
Confidence            589999999998643221              11111              1257788899997 7777654


No 21 
>PF12505 DUF3712:  Protein of unknown function (DUF3712);  InterPro: IPR022185  This domain family is found in eukaryotes, and is approximately 130 amino acids in length. 
Probab=53.20  E-value=1e+02  Score=23.65  Aligned_cols=66  Identities=12%  Similarity=-0.053  Sum_probs=38.9

Q ss_pred             eeeccCCCceecCCCeE-EEEEEEEeCCceeecCHHHHHHHHHHhhCCceEEEEEEEEEEEEEEEEeceEEEeeeeE
Q 036189          136 INHSVSPPFKVKPMKKS-TIHVQLATGDSLIFLNHQLLQKINSQRRNGRMVVFGLAVRAKTRFTGVSWLWWTEFANL  211 (241)
Q Consensus       136 lg~~~vp~F~q~~~~tt-~v~v~l~~~~~~~~l~~~~~~~l~~d~~~G~~v~~~v~v~~~vr~kv~~g~~~~~~~~~  211 (241)
                      +|...+|+..-.+..+. .++..+..      .+.+...++.++.-....+.+.++.+  ...++  |.++.....+
T Consensus         3 f~~~~lP~~~~~~~~~~~~~~~~l~i------~d~~~f~~f~~~~~~~~~~~l~l~g~--~~~~~--g~l~~~~i~~   69 (125)
T PF12505_consen    3 FATLDLPQIKIKGNGTISIIDQTLTI------TDQDAFTQFVTALLFNEEVTLTLRGK--TDTHL--GGLPFSGIPF   69 (125)
T ss_pred             eEEEECCCEEecCCceEEEeeeeEEe------cCHHHHHHHHHHHHhCCcEEEEEEEe--eeEEE--ccEEEEEEee
Confidence            88889999888332222 23233333      45566778887774433255555544  57777  8886544443


No 22 
>CHL00020 psbN photosystem II protein N
Probab=52.85  E-value=18  Score=23.02  Aligned_cols=21  Identities=19%  Similarity=0.249  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHhheeeEEecC
Q 036189           56 VAASISLTALICILMYFTLGP   76 (241)
Q Consensus        56 ~~~~i~llgl~~lil~lv~rP   76 (241)
                      +++..++++++...+|..|-|
T Consensus         9 i~i~~ll~~~Tgy~iYtaFGp   29 (43)
T CHL00020          9 IFISGLLVSFTGYALYTAFGQ   29 (43)
T ss_pred             HHHHHHHHHhhheeeeeccCC
Confidence            333457889999999999998


No 23 
>PF08113 CoxIIa:  Cytochrome c oxidase subunit IIa family;  InterPro: IPR012538 This family consists of the cytochrome c oxidase subunit IIa family. The bax-type cytochrome c oxidase from Thermus thermophilus is known as a two subunit enzyme. From its crystal structure, it was discovered that an additional transmembrane helix, subunit IIa, spans the membrane. This subunit consists of 34 residues forming one helix across the membrane. The presence of this subunit seems to be important for the function of cytochrome c oxidases [].; PDB: 2QPD_C 3QJR_C 3EH5_C 3BVD_C 3S39_C 3QJU_C 3QJS_C 4EV3_C 3QJT_C 4FA7_C ....
Probab=52.59  E-value=6  Score=23.78  Aligned_cols=13  Identities=8%  Similarity=0.508  Sum_probs=8.6

Q ss_pred             HHHHHHHhheeeE
Q 036189           60 ISLTALICILMYF   72 (241)
Q Consensus        60 i~llgl~~lil~l   72 (241)
                      +.++++++|++|+
T Consensus        12 v~iLt~~ILvFWf   24 (34)
T PF08113_consen   12 VMILTAFILVFWF   24 (34)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            3466677777774


No 24 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=50.51  E-value=6.3  Score=30.93  Aligned_cols=25  Identities=16%  Similarity=0.251  Sum_probs=9.9

Q ss_pred             HHHHHHhheeeEEec-CCCCEEEEee
Q 036189           61 SLTALICILMYFTLG-PKLPSLHLDT   85 (241)
Q Consensus        61 ~llgl~~lil~lv~r-Pk~P~f~V~s   85 (241)
                      -++|+++||+|++-| =|++...++.
T Consensus        76 GvIg~Illi~y~irR~~Kk~~~~~~p  101 (122)
T PF01102_consen   76 GVIGIILLISYCIRRLRKKSSSDVQP  101 (122)
T ss_dssp             HHHHHHHHHHHHHHHHS---------
T ss_pred             HHHHHHHHHHHHHHHHhccCCCCCCC
Confidence            445666777777654 3445555544


No 25 
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=50.16  E-value=7.3  Score=30.16  Aligned_cols=13  Identities=15%  Similarity=0.286  Sum_probs=8.4

Q ss_pred             HhheeeEEecCCC
Q 036189           66 ICILMYFTLGPKL   78 (241)
Q Consensus        66 ~~lil~lv~rPk~   78 (241)
                      ++.++||.+||+.
T Consensus        12 ~~~i~yf~iRPQk   24 (113)
T PRK06531         12 MLGLIFFMQRQQK   24 (113)
T ss_pred             HHHHHHheechHH
Confidence            3444567799964


No 26 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=48.23  E-value=3.6  Score=33.47  Aligned_cols=42  Identities=12%  Similarity=0.241  Sum_probs=26.1

Q ss_pred             HHHHHHhheeeEEecCCCCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCCeeEEEE
Q 036189           61 SLTALICILMYFTLGPKLPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDHLWQIYL  119 (241)
Q Consensus        61 ~llgl~~lil~lv~rPk~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y  119 (241)
                      +|+++++++||+..|+|.=.|         ++..+ .       .+++.++|+--.++|
T Consensus        62 ill~il~lvf~~c~r~kktdf---------idSdG-k-------vvtay~~n~~~~~w~  103 (154)
T PF04478_consen   62 ILLGILALVFIFCIRRKKTDF---------IDSDG-K-------VVTAYRSNKLTKWWY  103 (154)
T ss_pred             HHHHHHHhheeEEEecccCcc---------ccCCC-c-------EEEEEcCchHHHHHH
Confidence            456778888888999986443         22221 1       356777776555555


No 27 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=47.57  E-value=16  Score=23.37  Aligned_cols=18  Identities=28%  Similarity=0.506  Sum_probs=15.2

Q ss_pred             HHHHHHHHhheeeEEecC
Q 036189           59 SISLTALICILMYFTLGP   76 (241)
Q Consensus        59 ~i~llgl~~lil~lv~rP   76 (241)
                      ..++++++...+|..|.|
T Consensus        12 ~~~lv~~Tgy~iYtaFGp   29 (43)
T PF02468_consen   12 SCLLVSITGYAIYTAFGP   29 (43)
T ss_pred             HHHHHHHHhhhhhheeCC
Confidence            457888899999999987


No 28 
>PF14927 Neurensin:  Neurensin
Probab=47.42  E-value=48  Score=26.61  Aligned_cols=12  Identities=8%  Similarity=0.263  Sum_probs=7.0

Q ss_pred             HHHHHHHhheee
Q 036189           60 ISLTALICILMY   71 (241)
Q Consensus        60 i~llgl~~lil~   71 (241)
                      ++++|++++++-
T Consensus        54 ~Ll~Gi~~l~vg   65 (140)
T PF14927_consen   54 LLLLGIVALTVG   65 (140)
T ss_pred             HHHHHHHHHHhh
Confidence            357777555553


No 29 
>KOG0810 consensus SNARE protein Syntaxin 1 and related proteins [Intracellular trafficking, secretion, and vesicular transport]
Probab=44.63  E-value=7.6  Score=35.10  Aligned_cols=14  Identities=36%  Similarity=0.214  Sum_probs=5.5

Q ss_pred             CCCCCCCCchhhhH
Q 036189           37 YQHFQIKKLPKLII   50 (241)
Q Consensus        37 ~~~~~~~~~~rc~~   50 (241)
                      ||+..|++-|.|++
T Consensus       263 ~qkkaRK~k~i~ii  276 (297)
T KOG0810|consen  263 YQKKARKWKIIIII  276 (297)
T ss_pred             HHHHhhhceeeeeh
Confidence            44443333333333


No 30 
>COG4698 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.76  E-value=23  Score=29.68  Aligned_cols=30  Identities=27%  Similarity=0.497  Sum_probs=20.0

Q ss_pred             HhheeeEEecCCCCEEEEeeEEE---eeeecCC
Q 036189           66 ICILMYFTLGPKLPSLHLDTFSV---SNFTIGS   95 (241)
Q Consensus        66 ~~lil~lv~rPk~P~f~V~s~~l---~~f~~~~   95 (241)
                      +++++.+++.|+.|..++.+++=   ..|.+++
T Consensus        26 ~~~i~~~vlsp~ee~t~~~~a~~~~~~~fqitt   58 (197)
T COG4698          26 AVLIALFVLSPREEPTHLEDASEKSEKSFQITT   58 (197)
T ss_pred             HHHhheeeccCCCCCchhhccCcccceeEEEEc
Confidence            36666778999997777766544   3355543


No 31 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=42.28  E-value=9.6  Score=34.48  Aligned_cols=17  Identities=29%  Similarity=0.647  Sum_probs=11.6

Q ss_pred             HHHHHHHHhheeeEEec
Q 036189           59 SISLTALICILMYFTLG   75 (241)
Q Consensus        59 ~i~llgl~~lil~lv~r   75 (241)
                      +|+++.++.+|+||+||
T Consensus       264 aIliIVLIMvIIYLILR  280 (299)
T PF02009_consen  264 AILIIVLIMVIIYLILR  280 (299)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34555667788888766


No 32 
>PF11322 DUF3124:  Protein of unknown function (DUF3124);  InterPro: IPR021471  This bacterial family of proteins has no known function. 
Probab=41.35  E-value=1.7e+02  Score=23.05  Aligned_cols=53  Identities=15%  Similarity=0.295  Sum_probs=34.8

Q ss_pred             CceeEEEEEEEEEeCCCCeeEEEEccEEEEEEe--CCcccceeeeccCCCceecCCCeEEE
Q 036189           96 TNLIAKWDFNLTFKNPDHLWQIYLDYIECIALN--HDHFPIAINHSVSPPFKVKPMKKSTI  154 (241)
Q Consensus        96 ~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y--~g~~~~~lg~~~vp~F~q~~~~tt~v  154 (241)
                      .....+|+++|++||.+.+-.|+-.+.   -||  +|..   +-..--.|.+.++-.+..+
T Consensus        19 ~~~~~~Lt~tLSiRNtd~~~~i~i~~v---~Yydt~G~l---vr~yl~~Pi~L~Pl~t~~~   73 (125)
T PF11322_consen   19 KHRPFNLTATLSIRNTDPTDPIYITSV---DYYDTDGKL---VRSYLDKPIYLKPLATTEF   73 (125)
T ss_pred             CCceEeEEEEEEEEcCCCCCCEEEEEE---EEECCCCeE---hHHhcCCCeEcCCCceEEE
Confidence            466789999999999888777765433   234  3443   4444445677777777655


No 33 
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=40.95  E-value=2.6e+02  Score=24.81  Aligned_cols=17  Identities=12%  Similarity=0.202  Sum_probs=11.7

Q ss_pred             eeEEEEEEEEEeCCCCe
Q 036189           98 LIAKWDFNLTFKNPDHL  114 (241)
Q Consensus        98 l~~~~~~~l~v~NPN~k  114 (241)
                      +..+=++.+.++|.|..
T Consensus        84 i~s~~~v~~~~r~~~g~  100 (264)
T PF04790_consen   84 IQSSRNVTLNARNENGS  100 (264)
T ss_pred             EEecCceEEEEecCCCc
Confidence            44444577778888876


No 34 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=40.72  E-value=36  Score=31.83  Aligned_cols=12  Identities=17%  Similarity=0.606  Sum_probs=5.9

Q ss_pred             HHHHHHHhheee
Q 036189           60 ISLTALICILMY   71 (241)
Q Consensus        60 i~llgl~~lil~   71 (241)
                      +||+|++.+.+|
T Consensus        38 LIIlgLVLFmVY   49 (442)
T PF06637_consen   38 LIILGLVLFMVY   49 (442)
T ss_pred             HHHHHHHHHHhh
Confidence            455555444444


No 35 
>PHA02844 putative transmembrane protein; Provisional
Probab=39.85  E-value=30  Score=24.68  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=5.3

Q ss_pred             HHHHHhheeeE
Q 036189           62 LTALICILMYF   72 (241)
Q Consensus        62 llgl~~lil~l   72 (241)
                      ++.++.+.+||
T Consensus        59 ~~~~~~~flYL   69 (75)
T PHA02844         59 VFATFLTFLYL   69 (75)
T ss_pred             HHHHHHHHHHH
Confidence            33344455565


No 36 
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=38.28  E-value=32  Score=29.66  Aligned_cols=21  Identities=14%  Similarity=0.018  Sum_probs=11.2

Q ss_pred             HHHHHHhheeeEEecCCCCEE
Q 036189           61 SLTALICILMYFTLGPKLPSL   81 (241)
Q Consensus        61 ~llgl~~lil~lv~rPk~P~f   81 (241)
                      +++|..+..+|-++|||....
T Consensus       170 ~l~gGGa~yYfK~~K~K~~~~  190 (218)
T PF14283_consen  170 ALIGGGAYYYFKFYKPKQEEK  190 (218)
T ss_pred             HHhhcceEEEEEEeccccccc
Confidence            334443343334888886543


No 37 
>PF13131 DUF3951:  Protein of unknown function (DUF3951)
Probab=36.75  E-value=25  Score=23.24  Aligned_cols=31  Identities=19%  Similarity=0.310  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHHhheeeEE-ecCCCCE
Q 036189           50 IITLLVVAASISLTALICILMYFT-LGPKLPS   80 (241)
Q Consensus        50 ~~~~~~~~~~i~llgl~~lil~lv-~rPk~P~   80 (241)
                      +.++.++++.++++.++.++.|-. .+-+.|.
T Consensus         3 L~tiG~~~~~~~I~~lIgfity~mfV~K~s~q   34 (53)
T PF13131_consen    3 LLTIGIILFTIFIFFLIGFITYKMFVKKASPQ   34 (53)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhheecCCCc
Confidence            345555555566777777777744 3333343


No 38 
>PF11906 DUF3426:  Protein of unknown function (DUF3426);  InterPro: IPR021834  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 262 to 463 amino acids in length. 
Probab=36.46  E-value=2e+02  Score=22.44  Aligned_cols=57  Identities=12%  Similarity=0.099  Sum_probs=38.4

Q ss_pred             EEEeeEEEeeeecCC-CceeEEEEEEEEEeCCCCeeEEEEccEEEEEE-eCCcccceeeeccC
Q 036189           81 LHLDTFSVSNFTIGS-TNLIAKWDFNLTFKNPDHLWQIYLDYIECIAL-NHDHFPIAINHSVS  141 (241)
Q Consensus        81 f~V~s~~l~~f~~~~-~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~-Y~g~~~~~lg~~~v  141 (241)
                      -.++.+++....+.. +.-.-.+.++.+++|... ....|-.++++++ -+|+.   +++-.+
T Consensus        48 ~~~~~l~i~~~~~~~~~~~~~~l~v~g~i~N~~~-~~~~~P~l~l~L~D~~g~~---l~~r~~  106 (149)
T PF11906_consen   48 RDIDALKIESSDLRPVPDGPGVLVVSGTIRNRAD-FPQALPALELSLLDAQGQP---LARRVF  106 (149)
T ss_pred             cCcceEEEeeeeEEeecCCCCEEEEEEEEEeCCC-CcccCceEEEEEECCCCCE---EEEEEE
Confidence            355555555444432 234567888999999987 7888888888887 46665   665444


No 39 
>PRK08455 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=36.07  E-value=52  Score=27.47  Aligned_cols=15  Identities=0%  Similarity=-0.420  Sum_probs=10.8

Q ss_pred             EEccEEEEEEeCCcc
Q 036189          118 YLDYIECIALNHDHF  132 (241)
Q Consensus       118 ~Y~~~~v~v~Y~g~~  132 (241)
                      +|=...+.+.+.+..
T Consensus       103 ryLkv~i~Le~~~~~  117 (182)
T PRK08455        103 RYLKTSISLELSNEK  117 (182)
T ss_pred             eEEEEEEEEEECCHh
Confidence            787777777776653


No 40 
>PF04573 SPC22:  Signal peptidase subunit;  InterPro: IPR007653 Translocation of polypeptide chains across the endoplasmic reticulum membrane is triggered by signal sequences. During translocation of the nascent chain through the membrane, the signal sequence of most secretory and membrane proteins is cleaved off. Cleavage occurs by the signal peptidase complex (SPC), which consists of four subunits in yeast and five in mammals. This family is is described as similar to microsomal signal peptidase 23 kDa subunit. Found in eukaryotes [, ].; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=35.91  E-value=2.4e+02  Score=23.38  Aligned_cols=32  Identities=13%  Similarity=-0.028  Sum_probs=21.1

Q ss_pred             ceeEEEEEEEE-EeCCCCeeEEEEccEEEEEEeCCcc
Q 036189           97 NLIAKWDFNLT-FKNPDHLWQIYLDYIECIALNHDHF  132 (241)
Q Consensus        97 ~l~~~~~~~l~-v~NPN~k~~i~Y~~~~v~v~Y~g~~  132 (241)
                      .++.+++++++ .-|=|.|.-+-|    +.+.|.+..
T Consensus        65 ~i~fdl~aDls~lfnWNtKq~Fvy----v~A~Y~t~~   97 (175)
T PF04573_consen   65 KITFDLDADLSPLFNWNTKQLFVY----VTAEYETPK   97 (175)
T ss_pred             EEEEEeccCcccceeeeeeEEEEE----EEEEECCCC
Confidence            45555555555 478888888777    667776653


No 41 
>PF06024 DUF912:  Nucleopolyhedrovirus protein of unknown function (DUF912);  InterPro: IPR009261 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf78; it is a family of uncharacterised viral proteins.
Probab=35.59  E-value=48  Score=24.88  Aligned_cols=14  Identities=21%  Similarity=0.534  Sum_probs=6.6

Q ss_pred             HHHHhheeeE-EecC
Q 036189           63 TALICILMYF-TLGP   76 (241)
Q Consensus        63 lgl~~lil~l-v~rP   76 (241)
                      +.++.+|.|+ ++|=
T Consensus        75 lVily~IyYFVILRe   89 (101)
T PF06024_consen   75 LVILYAIYYFVILRE   89 (101)
T ss_pred             HHHHhhheEEEEEec
Confidence            3334445555 4553


No 42 
>PF10907 DUF2749:  Protein of unknown function (DUF2749);  InterPro: IPR024475 This bacterial family of proteins represent the TrbJ and TrbK genes of the Ti plasmid conjugative transfer operon [].
Probab=35.35  E-value=51  Score=22.95  Aligned_cols=16  Identities=13%  Similarity=0.270  Sum_probs=12.4

Q ss_pred             HHHHHhheeeEEecCC
Q 036189           62 LTALICILMYFTLGPK   77 (241)
Q Consensus        62 llgl~~lil~lv~rPk   77 (241)
                      +.+.+..+.|++.+|+
T Consensus        13 vaa~a~~atwviVq~~   28 (66)
T PF10907_consen   13 VAAAAGAATWVIVQPR   28 (66)
T ss_pred             HHhhhceeEEEEECCC
Confidence            4445778889999998


No 43 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=33.75  E-value=14  Score=34.64  Aligned_cols=34  Identities=24%  Similarity=0.256  Sum_probs=19.6

Q ss_pred             CCchhhhHHHHHHHHHHHHHHHHHhheee-EEecCC
Q 036189           43 KKLPKLIIITLLVVAASISLTALICILMY-FTLGPK   77 (241)
Q Consensus        43 ~~~~rc~~~~~~~~~~~i~llgl~~lil~-lv~rPk   77 (241)
                      ++++-..+. .|.+.++|++.||+.|+.| |+.|=|
T Consensus       362 s~LstgaIa-GIsvavvvvVgglvGfLcWwf~crgk  396 (397)
T PF03302_consen  362 SGLSTGAIA-GISVAVVVVVGGLVGFLCWWFICRGK  396 (397)
T ss_pred             cccccccee-eeeehhHHHHHHHHHHHhhheeeccc
Confidence            455556663 3334334567777777766 577644


No 44 
>PF09911 DUF2140:  Uncharacterized protein conserved in bacteria (DUF2140);  InterPro: IPR018672  This family of conserved hypothetical proteins has no known function. 
Probab=33.27  E-value=69  Score=26.79  Aligned_cols=20  Identities=15%  Similarity=0.331  Sum_probs=14.2

Q ss_pred             HHHHHHHhheeeEEecCCCC
Q 036189           60 ISLTALICILMYFTLGPKLP   79 (241)
Q Consensus        60 i~llgl~~lil~lv~rPk~P   79 (241)
                      .+++++++.+++.+++|..|
T Consensus        12 a~~l~~~~~~~~~~~~~~~~   31 (187)
T PF09911_consen   12 ALNLAFVIVVFFRLFQPSEP   31 (187)
T ss_pred             HHHHHHHhheeeEEEccCCC
Confidence            34555667777788999866


No 45 
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=33.25  E-value=36  Score=22.96  Aligned_cols=15  Identities=20%  Similarity=0.605  Sum_probs=10.4

Q ss_pred             HHHHhheeeEEecCC
Q 036189           63 TALICILMYFTLGPK   77 (241)
Q Consensus        63 lgl~~lil~lv~rPk   77 (241)
                      +-++++++|+.-||+
T Consensus        42 ~~~Ivv~vy~kTRP~   56 (56)
T PF15012_consen   42 FLFIVVFVYLKTRPR   56 (56)
T ss_pred             HHHHhheeEEeccCC
Confidence            334677888888884


No 46 
>PF09865 DUF2092:  Predicted periplasmic protein (DUF2092);  InterPro: IPR019207  This entry represents various hypothetical prokaryotic proteins of unknown function. 
Probab=32.98  E-value=3e+02  Score=23.57  Aligned_cols=36  Identities=14%  Similarity=0.002  Sum_probs=29.8

Q ss_pred             CceeEEEEEEEEEeCCCCeeEEEEc--cEEEEEEeCCcc
Q 036189           96 TNLIAKWDFNLTFKNPDHLWQIYLD--YIECIALNHDHF  132 (241)
Q Consensus        96 ~~l~~~~~~~l~v~NPN~k~~i~Y~--~~~v~v~Y~g~~  132 (241)
                      ..+.+.-+.+|.++=||+ +.+.+.  ..+..++|.|..
T Consensus        35 qklq~~~~~~v~v~RPdk-lr~~~~gd~~~~~~~yDGkt   72 (214)
T PF09865_consen   35 QKLQFSSSGTVTVQRPDK-LRIDRRGDGADREFYYDGKT   72 (214)
T ss_pred             ceEEEEEEEEEEEeCCCe-EEEEEEcCCcceEEEECCCE
Confidence            578888899999999997 988883  356789998886


No 47 
>PF06092 DUF943:  Enterobacterial putative membrane protein (DUF943);  InterPro: IPR010351 This family consists of several hypothetical proteins from Escherichia coli, Yersinia pestis and Salmonella typhi.
Probab=32.94  E-value=28  Score=28.54  Aligned_cols=16  Identities=38%  Similarity=0.555  Sum_probs=11.1

Q ss_pred             HHHHHHhheeeEEecC
Q 036189           61 SLTALICILMYFTLGP   76 (241)
Q Consensus        61 ~llgl~~lil~lv~rP   76 (241)
                      +++++++.++|+.+||
T Consensus        13 ~l~~~~~y~~W~~~rp   28 (157)
T PF06092_consen   13 FLLACILYFLWLTLRP   28 (157)
T ss_pred             HHHHHHHHhhhhccCC
Confidence            3444444888999999


No 48 
>PTZ00116 signal peptidase; Provisional
Probab=32.49  E-value=2.8e+02  Score=23.36  Aligned_cols=52  Identities=12%  Similarity=0.041  Sum_probs=31.8

Q ss_pred             CCCCEEEEeeEEEeeeecCC------CceeEEEEEEEE-EeCCCCeeEEEEccEEEEEEeCCc
Q 036189           76 PKLPSLHLDTFSVSNFTIGS------TNLIAKWDFNLT-FKNPDHLWQIYLDYIECIALNHDH  131 (241)
Q Consensus        76 Pk~P~f~V~s~~l~~f~~~~------~~l~~~~~~~l~-v~NPN~k~~i~Y~~~~v~v~Y~g~  131 (241)
                      ...|..+|+=..|.+|...+      ..++.+++++++ .-|=|.|.-|-|    +.+.|.+.
T Consensus        36 ~~~~~~~i~v~~V~~~~~~~~~~~D~a~i~fdl~~DL~~lfnWNtKqlFvy----v~a~Y~t~   94 (185)
T PTZ00116         36 EKEMSTNIKVKSVKRLVYNRHIKGDEAVLSLDLSYDMSKAFNWNLKQLFLY----VLVTYETP   94 (185)
T ss_pred             CCCceeeEEEeecccccccCCCCceeEEEEEeeccCchhcCCccccEEEEE----EEEEEcCC
Confidence            34455666555556676432      245566666665 468888888877    66677554


No 49 
>PF12505 DUF3712:  Protein of unknown function (DUF3712);  InterPro: IPR022185  This domain family is found in eukaryotes, and is approximately 130 amino acids in length. 
Probab=32.04  E-value=1.1e+02  Score=23.54  Aligned_cols=27  Identities=19%  Similarity=0.121  Sum_probs=19.7

Q ss_pred             eeEEEEEEEEEeCCCCeeEEEEccEEEE
Q 036189           98 LIAKWDFNLTFKNPDHLWQIYLDYIECI  125 (241)
Q Consensus        98 l~~~~~~~l~v~NPN~k~~i~Y~~~~v~  125 (241)
                      -.+++.+++++.||.. +++..+++...
T Consensus        98 ~g~~~~~~~~l~NPS~-~ti~lG~v~~~  124 (125)
T PF12505_consen   98 DGINLNATVTLPNPSP-LTIDLGNVTLN  124 (125)
T ss_pred             CcEEEEEEEEEcCCCe-EEEEeccEEEe
Confidence            3567888888999987 77766665543


No 50 
>PHA02650 hypothetical protein; Provisional
Probab=31.90  E-value=30  Score=25.00  Aligned_cols=11  Identities=9%  Similarity=0.329  Sum_probs=5.2

Q ss_pred             HHHHHhheeeE
Q 036189           62 LTALICILMYF   72 (241)
Q Consensus        62 llgl~~lil~l   72 (241)
                      ++.++.+.+||
T Consensus        60 ~i~~l~~flYL   70 (81)
T PHA02650         60 IIVALFSFFVF   70 (81)
T ss_pred             HHHHHHHHHHH
Confidence            33344455555


No 51 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=31.86  E-value=44  Score=34.29  Aligned_cols=27  Identities=22%  Similarity=0.273  Sum_probs=15.6

Q ss_pred             CCCCchhhhHHHHHHHHHHHHHHHHHh
Q 036189           41 QIKKLPKLIIITLLVVAASISLTALIC   67 (241)
Q Consensus        41 ~~~~~~rc~~~~~~~~~~~i~llgl~~   67 (241)
                      ++..|.|+++..+++++++++++|+++
T Consensus       133 ~~~~c~R~~l~~~L~~~~~~il~g~i~  159 (806)
T PF05478_consen  133 KNDACRRGCLGILLLLLTLIILFGVIC  159 (806)
T ss_pred             cccccchHHHHHHHHHHHHHHHHHHHH
Confidence            445566666655555555566666654


No 52 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=31.22  E-value=22  Score=21.94  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=4.6

Q ss_pred             HhheeeEEe
Q 036189           66 ICILMYFTL   74 (241)
Q Consensus        66 ~~lil~lv~   74 (241)
                      ...|||+++
T Consensus        24 mliif~f~l   32 (43)
T PF11395_consen   24 MLIIFWFSL   32 (43)
T ss_pred             HHHHHHHHH
Confidence            444556554


No 53 
>PF15145 DUF4577:  Domain of unknown function (DUF4577)
Probab=30.45  E-value=46  Score=25.72  Aligned_cols=26  Identities=19%  Similarity=0.501  Sum_probs=15.2

Q ss_pred             hHHHHHHHHHHHHHHHHHhheeeEEecC
Q 036189           49 IIITLLVVAASISLTALICILMYFTLGP   76 (241)
Q Consensus        49 ~~~~~~~~~~~i~llgl~~lil~lv~rP   76 (241)
                      +++.+++++  ++-++++.+++||+++-
T Consensus        63 ffvglii~L--ivSLaLVsFvIFLiiQT   88 (128)
T PF15145_consen   63 FFVGLIIVL--IVSLALVSFVIFLIIQT   88 (128)
T ss_pred             hHHHHHHHH--HHHHHHHHHHHHheeec
Confidence            333444443  56666677777777764


No 54 
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=30.15  E-value=71  Score=21.05  Aligned_cols=16  Identities=19%  Similarity=0.318  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHHHhh
Q 036189           53 LLVVAASISLTALICI   68 (241)
Q Consensus        53 ~~~~~~~i~llgl~~l   68 (241)
                      .+++.++++++||+++
T Consensus        18 GLi~A~vlfi~Gi~ii   33 (50)
T PF02038_consen   18 GLIFAGVLFILGILII   33 (50)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHH
Confidence            3444444566666544


No 55 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=29.90  E-value=20  Score=33.10  Aligned_cols=24  Identities=21%  Similarity=0.459  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHhheeeEEecC
Q 036189           53 LLVVAASISLTALICILMYFTLGP   76 (241)
Q Consensus        53 ~~~~~~~i~llgl~~lil~lv~rP   76 (241)
                      ++.-+++|+++.++.+|+||+||=
T Consensus       312 IiaSiIAIvvIVLIMvIIYLILRY  335 (353)
T TIGR01477       312 IIASIIAILIIVLIMVIIYLILRY  335 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            333333455666678888988764


No 56 
>PTZ00046 rifin; Provisional
Probab=28.86  E-value=22  Score=33.00  Aligned_cols=24  Identities=21%  Similarity=0.473  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHhheeeEEecC
Q 036189           53 LLVVAASISLTALICILMYFTLGP   76 (241)
Q Consensus        53 ~~~~~~~i~llgl~~lil~lv~rP   76 (241)
                      ++.-++.|+++.++.+|+||+||=
T Consensus       317 IiaSiiAIvVIVLIMvIIYLILRY  340 (358)
T PTZ00046        317 IIASIVAIVVIVLIMVIIYLILRY  340 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            333333455666678888998774


No 57 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=27.80  E-value=1.5e+02  Score=24.25  Aligned_cols=17  Identities=12%  Similarity=-0.115  Sum_probs=12.2

Q ss_pred             EEEEccEEEEEEeCCcc
Q 036189          116 QIYLDYIECIALNHDHF  132 (241)
Q Consensus       116 ~i~Y~~~~v~v~Y~g~~  132 (241)
                      +-+|=...+++.+++..
T Consensus        85 ~~ryLkv~i~l~~~d~~  101 (170)
T PRK05696         85 RDRLVQIKVQLMVRGSD  101 (170)
T ss_pred             CceEEEEEEEEEECCHH
Confidence            36787788888777654


No 58 
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=27.67  E-value=1.3e+02  Score=21.59  Aligned_cols=8  Identities=13%  Similarity=0.467  Sum_probs=4.0

Q ss_pred             HHHHhhee
Q 036189           63 TALICILM   70 (241)
Q Consensus        63 lgl~~lil   70 (241)
                      +|++++++
T Consensus        33 lGi~Ai~~   40 (82)
T PF04505_consen   33 LGIVAIVY   40 (82)
T ss_pred             HHHHHhee
Confidence            55555543


No 59 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=27.66  E-value=1.5e+02  Score=24.19  Aligned_cols=16  Identities=6%  Similarity=-0.027  Sum_probs=10.6

Q ss_pred             EEEccEEEEEEeCCcc
Q 036189          117 IYLDYIECIALNHDHF  132 (241)
Q Consensus       117 i~Y~~~~v~v~Y~g~~  132 (241)
                      .+|=.+.+.+.+.+..
T Consensus        86 ~ryLkv~i~L~~~~~~  101 (166)
T PRK12785         86 VQYLKLKVVLEVKDEK  101 (166)
T ss_pred             ceEEEEEEEEEECCHH
Confidence            4677777777776653


No 60 
>COG5009 MrcA Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane]
Probab=27.64  E-value=29  Score=35.29  Aligned_cols=31  Identities=26%  Similarity=0.360  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHhheeeEEecCCCCEEE
Q 036189           52 TLLVVAASISLTALICILMYFTLGPKLPSLH   82 (241)
Q Consensus        52 ~~~~~~~~i~llgl~~lil~lv~rPk~P~f~   82 (241)
                      +++++++++++.+.+++++++.+.|+.|.+.
T Consensus         8 ~l~i~~~~~l~g~~~~~~~~~~~~~dLPd~~   38 (797)
T COG5009           8 LLGILVTLILLGAGALAGLYLYISPDLPDVE   38 (797)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhccCCChH
Confidence            3333333334444466777778889988765


No 61 
>PHA03093 EEV glycoprotein; Provisional
Probab=27.02  E-value=40  Score=28.27  Aligned_cols=21  Identities=14%  Similarity=-0.088  Sum_probs=10.8

Q ss_pred             eCCCCeeEEEEccEEEEEEeCC
Q 036189          109 KNPDHLWQIYLDYIECIALNHD  130 (241)
Q Consensus       109 ~NPN~k~~i~Y~~~~v~v~Y~g  130 (241)
                      .|-+= -||.|+.--..+.++.
T Consensus        97 ~~~~C-~GI~~~~~C~~~~~ep  117 (185)
T PHA03093         97 HKESC-KGIVYDGSCYIFHSEP  117 (185)
T ss_pred             ccCcC-CCeecCCEeEEecCCC
Confidence            34443 4677775544444433


No 62 
>PF10614 CsgF:  Type VIII secretion system (T8SS), CsgF protein;  InterPro: IPR018893  Fimbriae are cell-surface protein polymers, of e.g. Escherichia coli and Salmonella spp, that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), that differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae (Tafi) are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp. and the controlling operon termed agf; however subsequent isolation of the homologous operon in E. coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix []. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery []. 
Probab=26.93  E-value=44  Score=26.91  Aligned_cols=11  Identities=27%  Similarity=0.392  Sum_probs=9.4

Q ss_pred             eEEecCCCCEE
Q 036189           71 YFTLGPKLPSL   81 (241)
Q Consensus        71 ~lv~rPk~P~f   81 (241)
                      =|||+|..|.|
T Consensus        23 eLVY~PvNPsF   33 (142)
T PF10614_consen   23 ELVYTPVNPSF   33 (142)
T ss_pred             heEeeccCCCC
Confidence            38999999976


No 63 
>PF13396 PLDc_N:  Phospholipase_D-nuclease N-terminal
Probab=24.82  E-value=84  Score=19.53  Aligned_cols=16  Identities=25%  Similarity=0.584  Sum_probs=11.8

Q ss_pred             HHHHHhheeeEEecCC
Q 036189           62 LTALICILMYFTLGPK   77 (241)
Q Consensus        62 llgl~~lil~lv~rPk   77 (241)
                      ++-++..++|++++.|
T Consensus        31 ~~P~iG~i~Yl~~gr~   46 (46)
T PF13396_consen   31 FFPIIGPILYLIFGRK   46 (46)
T ss_pred             HHHHHHHhheEEEeCC
Confidence            4566788889888764


No 64 
>PHA02673 ORF109 EEV glycoprotein; Provisional
Probab=24.37  E-value=28  Score=28.53  Aligned_cols=8  Identities=13%  Similarity=-0.338  Sum_probs=4.7

Q ss_pred             eEEEEccE
Q 036189          115 WQIYLDYI  122 (241)
Q Consensus       115 ~~i~Y~~~  122 (241)
                      -||+|+.-
T Consensus        78 ~GI~~~~~   85 (161)
T PHA02673         78 DGINAGNK   85 (161)
T ss_pred             CCcccCCe
Confidence            45666654


No 65 
>PF15050 SCIMP:  SCIMP protein
Probab=23.67  E-value=31  Score=26.99  Aligned_cols=10  Identities=10%  Similarity=0.458  Sum_probs=6.1

Q ss_pred             HhheeeEEec
Q 036189           66 ICILMYFTLG   75 (241)
Q Consensus        66 ~~lil~lv~r   75 (241)
                      +.||+|.++|
T Consensus        23 lglIlyCvcR   32 (133)
T PF15050_consen   23 LGLILYCVCR   32 (133)
T ss_pred             HHHHHHHHHH
Confidence            5666665555


No 66 
>PF04790 Sarcoglycan_1:  Sarcoglycan complex subunit protein;  InterPro: IPR006875 The dystrophin glycoprotein complex (DGC) is a membrane-spanning complex that links the interior cytoskeleton to the extracellular matrix in muscle. The sarcoglycan complex is a subcomplex within the DGC and is composed of several muscle-specific, transmembrane proteins (alpha-, beta-, gamma-, delta- and zeta-sarcoglycan). The sarcoglycans are asparagine-linked glycosylated proteins with single transmembrane domains. This family contains beta, gamma and delta members [, ].; GO: 0007010 cytoskeleton organization, 0016012 sarcoglycan complex, 0016021 integral to membrane
Probab=23.64  E-value=95  Score=27.56  Aligned_cols=11  Identities=0%  Similarity=0.145  Sum_probs=5.8

Q ss_pred             EEEEecceEEee
Q 036189          211 LMYTCLDLKVGF  222 (241)
Q Consensus       211 ~~v~C~~l~V~~  222 (241)
                      +.+.| .--+.+
T Consensus       199 I~~~a-~~di~L  209 (264)
T PF04790_consen  199 IEASA-RQDISL  209 (264)
T ss_pred             EEEEe-cCCEEE
Confidence            56666 444444


No 67 
>PF06835 LptC:  Lipopolysaccharide-assembly, LptC-related;  InterPro: IPR010664 This family consists of several related groups of proteins one of which is the LptC family. LptC is involved in lipopolysaccharide-assembly on the outer membrane of Gram-negative organisms.  The cell envelope of Gram-negative bacteria consists of an inner (IM) and an outer membrane (OM) separated by an aqueous compartment, the periplasm, which contains the peptidoglycan layer. The OM is an asymmetric bilayer, with phospholipids in the inner leaflet and lipopolysaccharides (LPS) facing outward [, ]. The OM is an effective permeability barrier that protects the cells from toxic compounds, such as antibiotics and detergents, thus allowing bacteria to inhabit several different and often hostile environments. LPS is responsible for the permeability properties of the OM. LPS consists of the lipid A moiety (a glucosamine-based phospholipid) linked to the short core oligosaccharide and the distal O-antigen polysaccharide chain. The core oligosaccharide can be further divided into an inner core, composed of 3-deoxy-D-mannooctulosanate (KDO) and heptose, and an outer core, which has a somewhat variable structure. LPS is essential in most Gram-negative bacteria, with the notable exception of Neisseria meningitidis. The biogenesis of the OM implies that the individual components are transported from the site of synthesis to their final destination outside the IM by crossing both hydrophilic and hydrophobic compartments. The machinery and the energy source that drive this process are not yet fully understood. The lipid A-core moiety and the O-antigen repeat units are synthesized at the cytoplasmic face of the IM and are separately exported via two independent transport systems, namely, the O-antigen transporter Wzx (RfbX) [, ] and the ATP binding cassette (ABC) transporter MsbA that flips the lipid A-core moiety from the inner leaflet to the outer leaflet of the IM [, , ]. O-antigen repeat units are then polymerised in the periplasm by the Wzy polymerase and ligated to the lipid A-core moiety by the WaaL ligase [see, , ]. The LPS transport machinery is composed of LptA, LptB, LptC, LptD, LptE. This supported by the fact, that depletion of any of one of these proteins blocks the LPS assembly pathway and results in very similar OM biogenesis defects. Moreover, the location of at least one of these five proteins in every cellular compartment suggests a model for how the LPS assembly pathway is organised and ordered in space []. Required for the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane [].; PDB: 3MY2_A.
Probab=23.45  E-value=78  Score=24.96  Aligned_cols=51  Identities=16%  Similarity=0.214  Sum_probs=12.7

Q ss_pred             CCEEEEeeEEEeeeecCCCceeEEEEEEEEEeCCCCeeEEEEccEEEEEEeCC
Q 036189           78 LPSLHLDTFSVSNFTIGSTNLIAKWDFNLTFKNPDHLWQIYLDYIECIALNHD  130 (241)
Q Consensus        78 ~P~f~V~s~~l~~f~~~~~~l~~~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g  130 (241)
                      .|.+.++++++..++-.+ .+...++..=..+++|.+. ++.+...+..+-.+
T Consensus        32 ~~~~~~~~~~~~~~~~~G-~~~~~l~A~~~~~~~~~~~-~~l~~p~~~~~~~~   82 (176)
T PF06835_consen   32 DPDYSIENFTLTQYDEDG-KLQWKLTAERAEHYPNSDT-VELEDPSLIIYDDD   82 (176)
T ss_dssp             ----------------------EEEE-SSEEEETTTTE-EEEES-EEEEE-TT
T ss_pred             CCcEEEEeeEEEEECCCC-CEEEEEEEeEEEEecCCCc-EEEeccEEEEEeCC
Confidence            345555555555443321 3444444443346665532 44445555444443


No 68 
>PF05545 FixQ:  Cbb3-type cytochrome oxidase component FixQ;  InterPro: IPR008621 This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon [].
Probab=23.20  E-value=48  Score=21.24  Aligned_cols=13  Identities=8%  Similarity=0.248  Sum_probs=7.1

Q ss_pred             HhheeeEEecCCC
Q 036189           66 ICILMYFTLGPKL   78 (241)
Q Consensus        66 ~~lil~lv~rPk~   78 (241)
                      .+.++|.+|+|+.
T Consensus        22 F~gi~~w~~~~~~   34 (49)
T PF05545_consen   22 FIGIVIWAYRPRN   34 (49)
T ss_pred             HHHHHHHHHcccc
Confidence            3444444678863


No 69 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=23.00  E-value=49  Score=22.68  Aligned_cols=13  Identities=23%  Similarity=0.570  Sum_probs=8.0

Q ss_pred             HhheeeEEecCCC
Q 036189           66 ICILMYFTLGPKL   78 (241)
Q Consensus        66 ~~lil~lv~rPk~   78 (241)
                      .+.++|.+|||+.
T Consensus        22 fiavi~~ayr~~~   34 (60)
T COG4736          22 FIAVIYFAYRPGK   34 (60)
T ss_pred             HHHHHHHHhcccc
Confidence            3445566788863


No 70 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=22.94  E-value=28  Score=24.17  Aligned_cols=15  Identities=13%  Similarity=0.295  Sum_probs=0.0

Q ss_pred             HHHHHhheeeEEecC
Q 036189           62 LTALICILMYFTLGP   76 (241)
Q Consensus        62 llgl~~lil~lv~rP   76 (241)
                      +++++++|++++||=
T Consensus        22 ll~ailLIlf~iyR~   36 (64)
T PF01034_consen   22 LLFAILLILFLIYRM   36 (64)
T ss_dssp             ---------------
T ss_pred             HHHHHHHHHHHHHHH
Confidence            444456666777764


No 71 
>COG1589 FtsQ Cell division septal protein [Cell envelope biogenesis, outer membrane]
Probab=22.90  E-value=1.2e+02  Score=26.68  Aligned_cols=30  Identities=23%  Similarity=0.383  Sum_probs=24.6

Q ss_pred             HHHHHHhheeeEEecCCCCEEEEeeEEEee
Q 036189           61 SLTALICILMYFTLGPKLPSLHLDTFSVSN   90 (241)
Q Consensus        61 ~llgl~~lil~lv~rPk~P~f~V~s~~l~~   90 (241)
                      +++++.++++|...-+..|.|.+..+.+++
T Consensus        40 ~~~~~~~~~~~~~~~~~~~~~~i~~v~v~G   69 (269)
T COG1589          40 VLLLLVLVVLWVLILLSLPYFPIRKVSVSG   69 (269)
T ss_pred             HHHHHHHHHHheehhhhcCCccceEEEEec
Confidence            455567778888888999999999999986


No 72 
>PF12321 DUF3634:  Protein of unknown function (DUF3634);  InterPro: IPR022090  This family of proteins is found in bacteria. Proteins in this family are typically between 103 and 114 amino acids in length. 
Probab=22.77  E-value=32  Score=26.44  Aligned_cols=17  Identities=12%  Similarity=0.444  Sum_probs=9.4

Q ss_pred             hheeeEE--ecCCCCEEEE
Q 036189           67 CILMYFT--LGPKLPSLHL   83 (241)
Q Consensus        67 ~lil~lv--~rPk~P~f~V   83 (241)
                      ++|+||+  .|-..|.|.|
T Consensus        10 ~li~~Lv~~~r~~~~vf~i   28 (108)
T PF12321_consen   10 ALIFWLVFVDRRGLPVFEI   28 (108)
T ss_pred             HHHHHHHHccccCceEEEE
Confidence            3777765  3433466654


No 73 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=22.76  E-value=55  Score=24.38  Aligned_cols=15  Identities=20%  Similarity=0.401  Sum_probs=7.3

Q ss_pred             HHHHHHhheee-EEec
Q 036189           61 SLTALICILMY-FTLG   75 (241)
Q Consensus        61 ~llgl~~lil~-lv~r   75 (241)
                      ++.+|+.+++| +++|
T Consensus        78 ~v~~lv~~l~w~f~~r   93 (96)
T PTZ00382         78 VVGGLVGFLCWWFVCR   93 (96)
T ss_pred             HHHHHHHHHhheeEEe
Confidence            34444444555 4555


No 74 
>PRK14759 potassium-transporting ATPase subunit F; Provisional
Probab=22.75  E-value=41  Score=19.59  Aligned_cols=19  Identities=26%  Similarity=0.308  Sum_probs=10.7

Q ss_pred             HHHHHHHhheeeEEecCCC
Q 036189           60 ISLTALICILMYFTLGPKL   78 (241)
Q Consensus        60 i~llgl~~lil~lv~rPk~   78 (241)
                      ++.+|+.+-.+|-++||.+
T Consensus        10 ~va~~L~vYL~~ALlrPEr   28 (29)
T PRK14759         10 AVSLGLLIYLTYALLRPER   28 (29)
T ss_pred             HHHHHHHHHHHHHHhCccc
Confidence            3444555555555688853


No 75 
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=22.26  E-value=74  Score=19.97  Aligned_cols=11  Identities=9%  Similarity=0.350  Sum_probs=5.7

Q ss_pred             HhheeeEEecC
Q 036189           66 ICILMYFTLGP   76 (241)
Q Consensus        66 ~~lil~lv~rP   76 (241)
                      ++++||+++|-
T Consensus        28 l~~~l~~~~rR   38 (40)
T PF08693_consen   28 LGAFLFFWYRR   38 (40)
T ss_pred             HHHHhheEEec
Confidence            34455555664


No 76 
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=22.14  E-value=66  Score=23.66  Aligned_cols=35  Identities=26%  Similarity=0.384  Sum_probs=11.6

Q ss_pred             EEEEeeEEEeeeecCCCceeEE--EEEEEEEeCCCCe
Q 036189           80 SLHLDTFSVSNFTIGSTNLIAK--WDFNLTFKNPDHL  114 (241)
Q Consensus        80 ~f~V~s~~l~~f~~~~~~l~~~--~~~~l~v~NPN~k  114 (241)
                      .-....++++++.++++.+...  =.++++++|.+..
T Consensus        19 ~~~~v~I~~~~~~f~P~~i~v~~G~~v~l~~~N~~~~   55 (104)
T PF13473_consen   19 AAQTVTITVTDFGFSPSTITVKAGQPVTLTFTNNDSR   55 (104)
T ss_dssp             -----------EEEES-EEEEETTCEEEEEEEE-SSS
T ss_pred             ccccccccccCCeEecCEEEEcCCCeEEEEEEECCCC
Confidence            3334455555666554433332  2456777776653


No 77 
>PHA03049 IMV membrane protein; Provisional
Probab=21.87  E-value=36  Score=23.77  Aligned_cols=17  Identities=18%  Similarity=0.288  Sum_probs=10.8

Q ss_pred             HHHHHHHhheeeEEecC
Q 036189           60 ISLTALICILMYFTLGP   76 (241)
Q Consensus        60 i~llgl~~lil~lv~rP   76 (241)
                      ++.+.+++||+|-+|+-
T Consensus         9 iICVaIi~lIvYgiYnk   25 (68)
T PHA03049          9 IICVVIIGLIVYGIYNK   25 (68)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            34455577777777764


No 78 
>PF13800 Sigma_reg_N:  Sigma factor regulator N-terminal
Probab=21.67  E-value=33  Score=25.18  Aligned_cols=12  Identities=8%  Similarity=0.277  Sum_probs=6.0

Q ss_pred             EEEEEeCCCCee
Q 036189          104 FNLTFKNPDHLW  115 (241)
Q Consensus       104 ~~l~v~NPN~k~  115 (241)
                      ..+.+.-||-.+
T Consensus        56 ~~~~it~PN~~~   67 (96)
T PF13800_consen   56 LAIEITYPNIYI   67 (96)
T ss_pred             HHHHhcCCCEeE
Confidence            344455566433


No 79 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=21.40  E-value=40  Score=23.62  Aligned_cols=17  Identities=24%  Similarity=0.350  Sum_probs=10.3

Q ss_pred             HHHHHHHhheeeEEecC
Q 036189           60 ISLTALICILMYFTLGP   76 (241)
Q Consensus        60 i~llgl~~lil~lv~rP   76 (241)
                      ++.+.++++|+|-+|+-
T Consensus         9 ~ICVaii~lIlY~iYnr   25 (68)
T PF05961_consen    9 IICVAIIGLILYGIYNR   25 (68)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            34445567777766654


No 80 
>PF00927 Transglut_C:  Transglutaminase family, C-terminal ig like domain;  InterPro: IPR008958 Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase  Transglutaminases catalyse the post-translational modification of proteins at glutamine residues, with formation of isopeptide bonds. Members of the transglutaminase family usually have three domains: N-terminal (IPR001102 from INTERPRO), middle (IPR013808 from INTERPRO) and C-terminal. The middle domain is usually well conserved, but family members can display major differences in their N- and C-terminal domains, although their overall structure is conserved []. This entry represents the C-terminal domain found in transglutaminases, which consists of an immunoglobulin-like beta-sandwich consisting of seven strands in two sheets with a Greek key topology. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot. Protein-glutamine gamma-glutamyltransferases (2.3.2.13 from EC) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [, ].; GO: 0003810 protein-glutamine gamma-glutamyltransferase activity, 0018149 peptide cross-linking; PDB: 2XZZ_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B 1L9N_B ....
Probab=21.22  E-value=3.3e+02  Score=19.90  Aligned_cols=61  Identities=11%  Similarity=0.158  Sum_probs=32.9

Q ss_pred             ceeEEEEEEEEEeCCCCee--EEEEccEEEEEEeCCcccceee--eccCCCceecCCCeEEEEEEEEe
Q 036189           97 NLIAKWDFNLTFKNPDHLW--QIYLDYIECIALNHDHFPIAIN--HSVSPPFKVKPMKKSTIHVQLAT  160 (241)
Q Consensus        97 ~l~~~~~~~l~v~NPN~k~--~i~Y~~~~v~v~Y~g~~~~~lg--~~~vp~F~q~~~~tt~v~v~l~~  160 (241)
                      .+.-++++.+++.||...-  .+.-.=....++|.|..   ..  .........+++++..+...+.-
T Consensus        12 ~vG~d~~v~v~~~N~~~~~l~~v~~~l~~~~v~ytG~~---~~~~~~~~~~~~l~p~~~~~~~~~i~p   76 (107)
T PF00927_consen   12 VVGQDFTVSVSFTNPSSEPLRNVSLNLCAFTVEYTGLT---RDQFKKEKFEVTLKPGETKSVEVTITP   76 (107)
T ss_dssp             BTTSEEEEEEEEEE-SSS-EECEEEEEEEEEEECTTTE---EEEEEEEEEEEEE-TTEEEEEEEEE-H
T ss_pred             cCCCCEEEEEEEEeCCcCccccceeEEEEEEEEECCcc---cccEeEEEcceeeCCCCEEEEEEEEEc
Confidence            4556889999999996521  12222234567888874   32  22334455566666666555543


No 81 
>PF15018 InaF-motif:  TRP-interacting helix
Probab=21.10  E-value=1.4e+02  Score=18.53  Aligned_cols=20  Identities=30%  Similarity=0.700  Sum_probs=9.8

Q ss_pred             HHHHHHHhheeeE-EecCCCC
Q 036189           60 ISLTALICILMYF-TLGPKLP   79 (241)
Q Consensus        60 i~llgl~~lil~l-v~rPk~P   79 (241)
                      +-+.++...+.|+ +..|+.|
T Consensus        17 VSl~Ai~LsiYY~f~W~p~~~   37 (38)
T PF15018_consen   17 VSLAAIVLSIYYIFFWDPDMP   37 (38)
T ss_pred             HHHHHHHHHHHHheeeCCCCC
Confidence            3445554555553 4456543


No 82 
>COG5294 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.87  E-value=2.5e+02  Score=21.71  Aligned_cols=13  Identities=15%  Similarity=0.416  Sum_probs=9.4

Q ss_pred             EEEEEEEEeCCCC
Q 036189          101 KWDFNLTFKNPDH  113 (241)
Q Consensus       101 ~~~~~l~v~NPN~  113 (241)
                      -.+.++++.|-|.
T Consensus        53 ~y~y~i~ayn~~G   65 (113)
T COG5294          53 GYEYTITAYNKNG   65 (113)
T ss_pred             cceeeehhhccCC
Confidence            4567788888776


No 83 
>COG2332 CcmE Cytochrome c-type biogenesis protein CcmE [Posttranslational modification, protein turnover, chaperones]
Probab=20.85  E-value=3.3e+02  Score=22.19  Aligned_cols=32  Identities=3%  Similarity=-0.064  Sum_probs=18.8

Q ss_pred             EEEEEEEEeCCCCeeEEEEccEEEEEEeCCcc
Q 036189          101 KWDFNLTFKNPDHLWQIYLDYIECIALNHDHF  132 (241)
Q Consensus       101 ~~~~~l~v~NPN~k~~i~Y~~~~v~v~Y~g~~  132 (241)
                      ++.+.+.+.--|+++.+.|..+-=+++=+|+.
T Consensus        71 ~~~v~F~vtD~~~~v~V~Y~GiLPDLFREGQg  102 (153)
T COG2332          71 SLKVSFVVTDGNKSVTVSYEGILPDLFREGQG  102 (153)
T ss_pred             CcEEEEEEecCCceEEEEEeccCchhhhcCCe
Confidence            34445555566666777776665555555554


No 84 
>PHA03265 envelope glycoprotein D; Provisional
Probab=20.52  E-value=58  Score=30.22  Aligned_cols=23  Identities=17%  Similarity=0.177  Sum_probs=13.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHhheee
Q 036189           47 KLIIITLLVVAASISLTALICILMY   71 (241)
Q Consensus        47 rc~~~~~~~~~~~i~llgl~~lil~   71 (241)
                      .++.+.+++.  .++++|+|+.++|
T Consensus       350 ~g~~ig~~i~--glv~vg~il~~~~  372 (402)
T PHA03265        350 VGISVGLGIA--GLVLVGVILYVCL  372 (402)
T ss_pred             cceEEccchh--hhhhhhHHHHHHh
Confidence            3444444333  3577777766666


No 85 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=20.50  E-value=81  Score=28.28  Aligned_cols=18  Identities=17%  Similarity=0.222  Sum_probs=11.6

Q ss_pred             HHHHHHhheeeEEecCCC
Q 036189           61 SLTALICILMYFTLGPKL   78 (241)
Q Consensus        61 ~llgl~~lil~lv~rPk~   78 (241)
                      +.+.|++||.||+.|=|.
T Consensus       282 a~lvlivLiaYli~Rrr~  299 (306)
T PF01299_consen  282 AGLVLIVLIAYLIGRRRS  299 (306)
T ss_pred             HHHHHHHHHhheeEeccc
Confidence            344456777888877553


No 86 
>PF02158 Neuregulin:  Neuregulin family;  InterPro: IPR002154 Neuregulins are a sub-family of EGF-like molecules that have been shown to play multiple essential roles in vertebrate embryogenesis including: cardiac development, Schwann cell and oligodendrocyte differentiation, some aspects of neuronal development, as well as the formation of neuromuscular synapses [, ]. Included in the family are heregulin; neu differentiation factor; acetylcholine receptor synthesis stimulator; glial growth factor; and sensory and motor-neuron derived factor []. Multiple family members are generated by alternate splicing or by use of several cell type-specific transcription initiation sites. In general, they bind to and activate the erbB family of receptor tyrosine kinases (erbB2 (HER2), erbB3 (HER3), and erbB4 (HER4)), functioning both as heterodimers and homodimers.  The transmembrane forms of neuregulin 1 (NRG1) are present within synaptic vesicles, including those containing glutamate []. After exocytosis, NRG1 is in the presynaptic membrane, where the ectodomain of NRG1 may be cleaved off. The ectodomain then migrates across the synaptic cleft and binds to and activates a member of the EGF-receptor family on the postsynaptic membrane. This has been shown to increase the expression of certain glutamate-receptor subunits. NRG1 appears to signal for glutamate-receptor subunit expression, localisation, and /or phosphorylation facilitating subsequent glutamate transmission.   The NRG1 gene has been identified as a potential gene determining susceptibility to schizophrenia by a combination of genetic linkage and association approaches []. ; GO: 0005102 receptor binding, 0009790 embryo development; PDB: 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=20.47  E-value=35  Score=31.89  Aligned_cols=23  Identities=26%  Similarity=0.671  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHhhe-eeE
Q 036189           48 LIIITLLVVAASISLTALICIL-MYF   72 (241)
Q Consensus        48 c~~~~~~~~~~~i~llgl~~li-l~l   72 (241)
                      -+-|++|||.  |+++|+++.+ +|.
T Consensus         9 VLTITgIcva--LlVVGi~Cvv~aYC   32 (404)
T PF02158_consen    9 VLTITGICVA--LLVVGIVCVVDAYC   32 (404)
T ss_dssp             --------------------------
T ss_pred             hhhhhhhhHH--HHHHHHHHHHHHHH
Confidence            3445555554  7889999998 884


No 87 
>PF14828 Amnionless:  Amnionless
Probab=20.43  E-value=61  Score=30.89  Aligned_cols=21  Identities=33%  Similarity=0.393  Sum_probs=12.0

Q ss_pred             HHHHHHhheeeEEecCCCCEE
Q 036189           61 SLTALICILMYFTLGPKLPSL   81 (241)
Q Consensus        61 ~llgl~~lil~lv~rPk~P~f   81 (241)
                      ++++++++++|+.+.|+.|.+
T Consensus       349 llv~ll~~~~ll~~~~~~~~l  369 (437)
T PF14828_consen  349 LLVALLFGVILLYRLPRNPSL  369 (437)
T ss_pred             HHHHHHHHhheEEeccccccc
Confidence            444555555565565666655


No 88 
>PF09049 SNN_transmemb:  Stannin transmembrane;  InterPro: IPR015135 This region consists of a single highly hydrophobic transmembrane helix that transverses the lipid bilayer at a 20 degree angle with respect to the membrane normal. It contains a conserved cysteine residue (Cys32) that, together with Cys34 found in the stannin unstructured linker domain, constitutes the putative trimethyltin-binding site that resides at the end of the transmembrane domain close to the lipid/solvent interface []. ; PDB: 1ZZA_A.
Probab=20.31  E-value=1.2e+02  Score=17.85  Aligned_cols=16  Identities=13%  Similarity=0.343  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHHHh
Q 036189           52 TLLVVAASISLTALIC   67 (241)
Q Consensus        52 ~~~~~~~~i~llgl~~   67 (241)
                      +++++++.+..+|+.+
T Consensus        14 ti~viliavaalg~li   29 (33)
T PF09049_consen   14 TIIVILIAVAALGALI   29 (33)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             EehhHHHHHHHHhhhh
Confidence            4444443333444433


Done!