Query         036217
Match_columns 196
No_of_seqs    54 out of 56
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 10:35:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036217.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036217hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05542 DUF760:  Protein of un  99.1 1.8E-11 3.9E-16   91.3   1.8   55   21-75     14-69  (86)
  2 PF05542 DUF760:  Protein of un  97.5 0.00024 5.2E-09   53.1   5.7   76  102-185     2-77  (86)
  3 PF14875 PIP49_N:  N-term cyste  61.6      16 0.00034   30.5   4.6   48   10-59    107-155 (158)
  4 PF08763 Ca_chan_IQ:  Voltage g  45.4     9.5 0.00021   25.1   0.6   14   61-74      3-16  (35)
  5 PRK12853 glucose-6-phosphate 1  40.3      14 0.00031   35.7   1.3   21   33-53    230-250 (482)
  6 COG0364 Zwf Glucose-6-phosphat  37.2      19 0.00041   35.3   1.5   21   33-53    230-250 (483)
  7 PRK12854 glucose-6-phosphate 1  35.2      19 0.00041   35.0   1.2   20   34-53    239-258 (484)
  8 PRK05722 glucose-6-phosphate 1  34.9      21 0.00045   34.7   1.4   21   33-53    240-260 (495)
  9 PLN02539 glucose-6-phosphate 1  34.0      21 0.00045   34.8   1.3   21   33-53    250-270 (491)
 10 PF02781 G6PD_C:  Glucose-6-pho  33.5       9 0.00019   34.8  -1.2   20   34-53     46-65  (293)
 11 TIGR00871 zwf glucose-6-phosph  33.3      22 0.00047   34.5   1.3   21   33-53    231-251 (482)
 12 PF12835 Integrase_1:  Integras  32.1      93   0.002   26.1   4.7   60  115-176    39-103 (187)
 13 PTZ00309 glucose-6-phosphate 1  31.0      26 0.00057   34.6   1.4   21   33-53    286-306 (542)
 14 PLN02640 glucose-6-phosphate 1  30.5      26 0.00057   34.9   1.3   21   33-53    317-337 (573)
 15 COG5664 Predicted secreted Zn-  29.2      33 0.00072   30.2   1.6   47   25-71    124-172 (201)
 16 PF12931 Sec16_C:  Sec23-bindin  27.5      38 0.00082   29.8   1.7   38   37-74    100-139 (284)
 17 PF12476 DUF3696:  Protein of u  25.6      36 0.00077   22.9   0.9   12    9-20     27-38  (52)
 18 PF11226 DUF3022:  Protein of u  25.0      40 0.00087   27.1   1.3   42   99-140    44-89  (111)
 19 PLN02333 glucose-6-phosphate 1  24.9      38 0.00083   34.1   1.4   21   33-53    346-366 (604)
 20 cd08571 GDPD_SHV3_plant Glycer  24.1      37 0.00079   30.3   1.0   19  104-122   170-188 (302)
 21 PF04071 zf-like:  Cysteine-ric  23.5      77  0.0017   24.4   2.5   23   26-48     58-80  (86)
 22 PF08353 DUF1727:  Domain of un  22.8      29 0.00063   27.2   0.1    7  178-184    39-45  (113)
 23 PF10678 DUF2492:  Protein of u  21.3      44 0.00095   25.3   0.8   14   25-38      1-14  (78)
 24 COG3750 Uncharacterized protei  20.4 1.3E+02  0.0028   23.4   3.2   27  108-134    47-73  (85)

No 1  
>PF05542 DUF760:  Protein of unknown function (DUF760);  InterPro: IPR008479 This entry contains uncharacterised proteins.
Probab=99.13  E-value=1.8e-11  Score=91.29  Aligned_cols=55  Identities=33%  Similarity=0.422  Sum_probs=49.6

Q ss_pred             ccccccccCCHHHHHHHHHHHHHHhccc-ccCCchhhhhhhccccccchhhhHhhH
Q 036217           21 QEQKLESVHSPEAFEMIQSHLSLVLGER-LVGPLDTIIQISKIKLGKLYAASIMYD   75 (196)
Q Consensus        21 ~~~kLEsiHS~EalEMI~eHL~~ilG~r-~~~~~~t~~qiskl~~gqvYAASIMYe   75 (196)
                      .-..++.+|||||+|+|++|+..+||.. ...+.++++++++.++||+||+++||.
T Consensus        14 ~~~~l~~~~s~ev~e~m~~~v~~llG~l~p~~~~~~~i~~s~~~La~L~~~~mm~G   69 (86)
T PF05542_consen   14 RIQQLSEPASPEVLEAMKQHVSGLLGNLSPSDQFNVTIQTSRENLAQLLAWSMMTG   69 (86)
T ss_pred             HHHHhhccCCHHHHHHHHHHHHHHHcCCCCcccCcceeEECHHHHHHHHHHHHHHh
Confidence            3345889999999999999999999999 556779999999999999999999993


No 2  
>PF05542 DUF760:  Protein of unknown function (DUF760);  InterPro: IPR008479 This entry contains uncharacterised proteins.
Probab=97.52  E-value=0.00024  Score=53.09  Aligned_cols=76  Identities=20%  Similarity=0.295  Sum_probs=67.6

Q ss_pred             hhhhhhhccCHHHHHHHHhhhhHHHHHHHHHhhhhhcCCCceeecCCCCcccCCCceEEEechhhHHHHHHHHhhccccc
Q 036217          102 RLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIRVLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMW  181 (196)
Q Consensus       102 ~Lr~YVm~FD~eTLqr~A~iRSkEav~lIEkht~ALFG~p~i~i~~~Gsv~~~~de~i~isfs~LkrLVLEAVaFGSFLW  181 (196)
                      .|=.||.+.+||++++.++.-|.|++..|++|...+-|.-.        .....+-+|.++=..|-+|..=++.+|=|||
T Consensus         2 ~L~~yi~~l~pe~~~~l~~~~s~ev~e~m~~~v~~llG~l~--------p~~~~~~~i~~s~~~La~L~~~~mm~GYfLr   73 (86)
T PF05542_consen    2 DLLQYIQSLKPERIQQLSEPASPEVLEAMKQHVSGLLGNLS--------PSDQFNVTIQTSRENLAQLLAWSMMTGYFLR   73 (86)
T ss_pred             hHHHHHHHCCHHHHHHhhccCCHHHHHHHHHHHHHHHcCCC--------CcccCcceeEECHHHHHHHHHHHHHHhHHHH
Confidence            57789999999999999999999999999999999999552        1235667899999999999999999999999


Q ss_pred             cccc
Q 036217          182 DSES  185 (196)
Q Consensus       182 DvEs  185 (196)
                      .+|-
T Consensus        74 ~~E~   77 (86)
T PF05542_consen   74 NAEQ   77 (86)
T ss_pred             HHHH
Confidence            9873


No 3  
>PF14875 PIP49_N:  N-term cysteine-rich ER, FAM69
Probab=61.64  E-value=16  Score=30.54  Aligned_cols=48  Identities=27%  Similarity=0.259  Sum_probs=34.0

Q ss_pred             CCCCccccCCCccccccccCC-HHHHHHHHHHHHHHhcccccCCchhhhhh
Q 036217           10 DPVGRVDFWPNQEQKLESVHS-PEAFEMIQSHLSLVLGERLVGPLDTIIQI   59 (196)
Q Consensus        10 ~~~grvd~wP~~~~kLEsiHS-~EalEMI~eHL~~ilG~r~~~~~~t~~qi   59 (196)
                      .++-.-+.||.++..++-.=| .|-.|||++|+-..+|...  +.+.+.+|
T Consensus       107 ~~~~~~~~~~~~e~~~~~~Ps~~ef~eMV~~~lk~~lG~~~--~~~lv~~l  155 (158)
T PF14875_consen  107 SYDFEPLSWPRSELVLFDKPSMEEFREMVKSFLKNKLGDQL--SNNLVERL  155 (158)
T ss_pred             ccccccccccccccccCCCCCHHHHHHHHHHHHHHHhCCCC--CHHHHHHH
Confidence            446666799988755544444 3578999999999999984  35555554


No 4  
>PF08763 Ca_chan_IQ:  Voltage gated calcium channel IQ domain;  InterPro: IPR014873 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. The voltage-gated calcium channel alpha 1 subunit contains an IQ domain, named for its isoleucine-glutamine (IQ) motif, which interacts with hydrophobic pockets of Ca2+/calmodulin []. The interaction regulates two self-regulatory calcium dependent feedback mechanisms, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF). ; PDB: 3OXQ_F 2F3Z_B 3G43_E 2F3Y_B 2BE6_D 3DVM_B 3BXK_D 2VAY_B 3DVK_B 3BXL_B ....
Probab=45.41  E-value=9.5  Score=25.15  Aligned_cols=14  Identities=29%  Similarity=0.721  Sum_probs=11.9

Q ss_pred             ccccccchhhhHhh
Q 036217           61 KIKLGKLYAASIMY   74 (196)
Q Consensus        61 kl~~gqvYAASIMY   74 (196)
                      .+.+|++|||=++|
T Consensus         3 ~~TVGK~YAt~lI~   16 (35)
T PF08763_consen    3 EVTVGKFYATLLIQ   16 (35)
T ss_dssp             -CCCHHHHHHHHHH
T ss_pred             cchhHHHHHHHHHH
Confidence            47799999999988


No 5  
>PRK12853 glucose-6-phosphate 1-dehydrogenase; Provisional
Probab=40.31  E-value=14  Score=35.72  Aligned_cols=21  Identities=29%  Similarity=0.351  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..||..-++-++
T Consensus       230 lRDmvQNHLlQlLalvAME~P  250 (482)
T PRK12853        230 LRDMVQNHLLQLLALVAMEPP  250 (482)
T ss_pred             HHHHHHHHHHHHHHHHhhCCC
Confidence            458999999999999865544


No 6  
>COG0364 Zwf Glucose-6-phosphate 1-dehydrogenase [Carbohydrate transport and metabolism]
Probab=37.18  E-value=19  Score=35.35  Aligned_cols=21  Identities=29%  Similarity=0.311  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .=+||||||..+|..-++-++
T Consensus       230 lRDMvQNHlLQlL~LvAME~P  250 (483)
T COG0364         230 LRDMVQNHLLQLLCLVAMEPP  250 (483)
T ss_pred             HHHHHHHHHHHHHHHHhcCCC
Confidence            348999999999999865444


No 7  
>PRK12854 glucose-6-phosphate 1-dehydrogenase; Provisional
Probab=35.22  E-value=19  Score=35.01  Aligned_cols=20  Identities=30%  Similarity=0.325  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHhcccccCCc
Q 036217           34 FEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        34 lEMI~eHL~~ilG~r~~~~~   53 (196)
                      -+||||||..+|..-++-++
T Consensus       239 RDmvQNHLlQlLalvAMEpP  258 (484)
T PRK12854        239 RDMVVTHLFQVLAFVAMEPP  258 (484)
T ss_pred             HHHHHHHHHHHHHHHHhCCC
Confidence            48999999999998875544


No 8  
>PRK05722 glucose-6-phosphate 1-dehydrogenase; Validated
Probab=34.86  E-value=21  Score=34.70  Aligned_cols=21  Identities=29%  Similarity=0.351  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..+|..-++-++
T Consensus       240 lRDmvQNHLlQlLalvAME~P  260 (495)
T PRK05722        240 LRDMVQNHLLQLLALVAMEPP  260 (495)
T ss_pred             HHHHHHHHHHHHHHHHhcCCC
Confidence            358999999999998865544


No 9  
>PLN02539 glucose-6-phosphate 1-dehydrogenase
Probab=33.96  E-value=21  Score=34.81  Aligned_cols=21  Identities=29%  Similarity=0.199  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..+|..-++-++
T Consensus       250 lRDmvQNHLlQlLalvAMEpP  270 (491)
T PLN02539        250 IRDIIQNHLLQVLCLVAMEKP  270 (491)
T ss_pred             HHHHHHHHHHHHHHHHHhCCc
Confidence            348999999999998865544


No 10 
>PF02781 G6PD_C:  Glucose-6-phosphate dehydrogenase, C-terminal domain;  InterPro: IPR022675 Glucose-6-phosphate dehydrogenase (1.1.1.49 from EC) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types []. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells []. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes []. This entry represents the C-terminal domain of glucose-6-phosphate dehydrogenase.; GO: 0004345 glucose-6-phosphate dehydrogenase activity, 0050661 NADP binding, 0006006 glucose metabolic process, 0055114 oxidation-reduction process; PDB: 1QKI_E 2BH9_A 2BHL_A 4EM5_C 4E9I_A 2DPG_A 1E77_A 1E7M_A 1H9B_A 1E7Y_A ....
Probab=33.46  E-value=9  Score=34.76  Aligned_cols=20  Identities=30%  Similarity=0.388  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHhcccccCCc
Q 036217           34 FEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        34 lEMI~eHL~~ilG~r~~~~~   53 (196)
                      -+||||||..||..-+.-++
T Consensus        46 RDmvQNHllQlL~lvaMe~P   65 (293)
T PF02781_consen   46 RDMVQNHLLQLLALVAMEPP   65 (293)
T ss_dssp             HHTTTTHHHHHHHHHH----
T ss_pred             HHHHHHHHHHHHHHHHhcCc
Confidence            48999999999998865443


No 11 
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase. This is a well-studied enzyme family, with sequences available from well over 50 species. The trusted cutoff is set above the score for the Drosophila melanogaster CG7140 gene product, a homolog of unknown function. G6PD homologs from the bacteria Aquifex aeolicus and Helicobacter pylori lack several motifs well conserved most other members, were omitted from the seed alignment, and score well below the trusted cutoff.
Probab=33.28  E-value=22  Score=34.46  Aligned_cols=21  Identities=29%  Similarity=0.311  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..+|..-++-++
T Consensus       231 lRDmvQNHLlQlL~lvAMe~P  251 (482)
T TIGR00871       231 LRDMVQNHLLQLLCLVAMEPP  251 (482)
T ss_pred             HHHHHHhHHHHHHHHHHcCCC
Confidence            358999999999998865544


No 12 
>PF12835 Integrase_1:  Integrase;  InterPro: IPR024456 Phage integrase proteins cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment [, ]. This entry represents the catalytic domain from a family of putative prophage DNA-binding integrases.
Probab=32.10  E-value=93  Score=26.08  Aligned_cols=60  Identities=22%  Similarity=0.168  Sum_probs=35.4

Q ss_pred             HHHHHhhhhHHHHHHHHHhh---hhhcC-CCceeecCCCCcccCCCceEEEe-chhhHHHHHHHHhh
Q 036217          115 LQRYATIRSKEAISLIEKQT---QALFG-RPDIRVLEDGSIDTSKDEVISVT-FLGLTMLVLEAVAF  176 (196)
Q Consensus       115 Lqr~A~iRSkEav~lIEkht---~ALFG-~p~i~i~~~Gsv~~~~de~i~is-fs~LkrLVLEAVaF  176 (196)
                      ||+..=||.+||+.+-=.+.   .||.. ...+.|...+.-  ...-.|.|+ -..++.++-+|-+|
T Consensus        39 Lq~~fGLR~~Ea~~l~~~~~~w~~~l~~~~~~~~v~~gtKG--Gr~R~v~I~~~~~~~~~L~~a~~~  103 (187)
T PF12835_consen   39 LQRAFGLRREEALKLRPSLATWEKALERGDETLRVVVGTKG--GRPREVPILDSEKQREALERAAAV  103 (187)
T ss_pred             HHHHhCCCHHHHHhccHhhhhHHHHHhcCCCceEEeecCCC--CCcceecCCCcHHHHHHHHHHHHH
Confidence            89999999999999855554   44664 333333322111  223445554 55666666666543


No 13 
>PTZ00309 glucose-6-phosphate 1-dehydrogenase; Provisional
Probab=31.02  E-value=26  Score=34.63  Aligned_cols=21  Identities=19%  Similarity=0.192  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..||..-++-++
T Consensus       286 lRDmvQNHLlQlLalvAMEpP  306 (542)
T PTZ00309        286 IRDVMQNHLLQILALLAMEKP  306 (542)
T ss_pred             HHHHHHHHHHHHHHHHhcCCC
Confidence            358999999999998875544


No 14 
>PLN02640 glucose-6-phosphate 1-dehydrogenase
Probab=30.48  E-value=26  Score=34.92  Aligned_cols=21  Identities=19%  Similarity=0.202  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..+|..-++-++
T Consensus       317 lRDMvQNHLlQlLaLvAMEpP  337 (573)
T PLN02640        317 IRDIMQNHLLQILALFAMETP  337 (573)
T ss_pred             HHHHHHHHHHHHHHHHHcCCC
Confidence            358999999999999875544


No 15 
>COG5664 Predicted secreted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=29.24  E-value=33  Score=30.16  Aligned_cols=47  Identities=26%  Similarity=0.265  Sum_probs=35.2

Q ss_pred             ccccCCHHHHHHHHHHHHHHhcccccCCc--hhhhhhhccccccchhhh
Q 036217           25 LESVHSPEAFEMIQSHLSLVLGERLVGPL--DTIIQISKIKLGKLYAAS   71 (196)
Q Consensus        25 LEsiHS~EalEMI~eHL~~ilG~r~~~~~--~t~~qiskl~~gqvYAAS   71 (196)
                      -|-+|+--+.||+++--..+.|.+..+++  .-+-+.-..++|-+|++-
T Consensus       124 HE~vHG~~~~~Mv~~iea~t~GL~vanDPkC~K~R~e~~~rl~~is~~q  172 (201)
T COG5664         124 HELVHGDHAKEMVRAIEAATTGLRVANDPKCRKIRRELQKRLGAISAEQ  172 (201)
T ss_pred             HHHHhHHHHHHHHHHHHHHhcccccCCChhHHHHHHHHHHHHHHHHHHH
Confidence            58899999999999999999999953444  223333346788888764


No 16 
>PF12931 Sec16_C:  Sec23-binding domain of Sec16; PDB: 3MZK_C.
Probab=27.55  E-value=38  Score=29.85  Aligned_cols=38  Identities=21%  Similarity=0.364  Sum_probs=24.2

Q ss_pred             HHHHHHHHhcccccCCchhhhhhhcc--ccccchhhhHhh
Q 036217           37 IQSHLSLVLGERLVGPLDTIIQISKI--KLGKLYAASIMY   74 (196)
Q Consensus        37 I~eHL~~ilG~r~~~~~~t~~qiskl--~~gqvYAASIMY   74 (196)
                      =||||+.|+-++..++..++..+-++  +-|+++||.|.|
T Consensus       100 Wre~lA~il~N~~~~~~~~l~~LGd~L~~~g~~~aA~iCY  139 (284)
T PF12931_consen  100 WRETLAIILSNRTPEDSQALCALGDRLWQRGRVEAAHICY  139 (284)
T ss_dssp             HHHHHHHHHHTS---SS-TT--HHHHHHHTT-HHHHHHHH
T ss_pred             HHHHHHHHHhCCCcccHHHHHHHHHHHHhCCCcchhHHHH
Confidence            68999999999965555555443332  447899999999


No 17 
>PF12476 DUF3696:  Protein of unknown function (DUF3696);  InterPro: IPR022532  This domain is found in bacteria and archaea, and is approximately 50 amino acids in length. 
Probab=25.64  E-value=36  Score=22.92  Aligned_cols=12  Identities=42%  Similarity=0.908  Sum_probs=10.2

Q ss_pred             CCCCCccccCCC
Q 036217            9 SDPVGRVDFWPN   20 (196)
Q Consensus         9 ~~~~grvd~wP~   20 (196)
                      .+.+|+++.||.
T Consensus        27 id~~G~l~~WP~   38 (52)
T PF12476_consen   27 IDEDGRLSNWPE   38 (52)
T ss_pred             ECCCCCCccCCC
Confidence            467999999995


No 18 
>PF11226 DUF3022:  Protein of unknown function (DUF3022);  InterPro: IPR021389  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=25.03  E-value=40  Score=27.09  Aligned_cols=42  Identities=19%  Similarity=0.308  Sum_probs=26.0

Q ss_pred             ccchhhhhh-hccCHHHHHHHHhhhhHHHHH---HHHHhhhhhcCC
Q 036217           99 KSYRLRSYV-MYLDAETLQRYATIRSKEAIS---LIEKQTQALFGR  140 (196)
Q Consensus        99 k~~~Lr~YV-m~FD~eTLqr~A~iRSkEav~---lIEkht~ALFG~  140 (196)
                      .|..-||=| ..|||.+|+|||-|....=.-   ..=-..++-||+
T Consensus        44 ~~~~~R~~v~lrf~~~~l~RYaald~~~R~Rv~a~L~a~v~~~l~~   89 (111)
T PF11226_consen   44 TPRDARCAVDLRFDPDVLARYAALDTAARARVHARLRAYVRATLDS   89 (111)
T ss_pred             CcccceEEEEEEECHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHh
Confidence            344446544 579999999998654433221   233456777776


No 19 
>PLN02333 glucose-6-phosphate 1-dehydrogenase
Probab=24.92  E-value=38  Score=34.06  Aligned_cols=21  Identities=19%  Similarity=0.202  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHhcccccCCc
Q 036217           33 AFEMIQSHLSLVLGERLVGPL   53 (196)
Q Consensus        33 alEMI~eHL~~ilG~r~~~~~   53 (196)
                      .-+||||||..||..-++-++
T Consensus       346 iRDmvQNHLLQlLaLvAME~P  366 (604)
T PLN02333        346 IRDIMQNHLLQILALFAMETP  366 (604)
T ss_pred             HHHHHHHHHHHHHHHHHcCCC
Confidence            358999999999998865544


No 20 
>cd08571 GDPD_SHV3_plant Glycerophosphodiester phosphodiesterase domain of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase (GDPD) domain present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play an important role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP-GDEs are not conserv
Probab=24.09  E-value=37  Score=30.27  Aligned_cols=19  Identities=16%  Similarity=0.329  Sum_probs=16.8

Q ss_pred             hhhhhccCHHHHHHHHhhh
Q 036217          104 RSYVMYLDAETLQRYATIR  122 (196)
Q Consensus       104 r~YVm~FD~eTLqr~A~iR  122 (196)
                      |.+|+|||+++|+++.++.
T Consensus       170 ~v~i~SF~~~~L~~~~~~~  188 (302)
T cd08571         170 KVYISSPDSSVLKSFKKRV  188 (302)
T ss_pred             CEEEeCCCHHHHHHHHhcc
Confidence            6789999999999998764


No 21 
>PF04071 zf-like:  Cysteine-rich small domain;  InterPro: IPR007212 This is a probable metal-binding domain. It is found in a probable precorrin-3B C17-methyltransferase from Methanobacterium thermoautotrophicum, that catalyses the methylation of C-17 in precorrin-3B to form precorrin-4.
Probab=23.53  E-value=77  Score=24.38  Aligned_cols=23  Identities=26%  Similarity=0.444  Sum_probs=19.9

Q ss_pred             cccCCHHHHHHHHHHHHHHhccc
Q 036217           26 ESVHSPEAFEMIQSHLSLVLGER   48 (196)
Q Consensus        26 EsiHS~EalEMI~eHL~~ilG~r   48 (196)
                      --+|-+|+++.|.+|+..++...
T Consensus        58 ~~~H~~e~~~~i~~~~~~~~~~~   80 (86)
T PF04071_consen   58 TLPHRPENYDYIIRKLKEIIEEL   80 (86)
T ss_pred             CCccCHHHHHHHHHHHHHHHHHH
Confidence            35899999999999999988654


No 22 
>PF08353 DUF1727:  Domain of unknown function (DUF1727);  InterPro: IPR013564 This domain of unknown function is found at the C terminus of bacterial proteins which include UDP-N-acetylmuramyl tripeptide synthase and the related Mur ligase. 
Probab=22.82  E-value=29  Score=27.24  Aligned_cols=7  Identities=43%  Similarity=1.374  Sum_probs=5.7

Q ss_pred             ccccccc
Q 036217          178 SFMWDSE  184 (196)
Q Consensus       178 SFLWDvE  184 (196)
                      |||||+.
T Consensus        39 SWiWDvd   45 (113)
T PF08353_consen   39 SWIWDVD   45 (113)
T ss_pred             eEEeecC
Confidence            8999973


No 23 
>PF10678 DUF2492:  Protein of unknown function (DUF2492);  InterPro: IPR019620  This entry describes a family of small cytosolic proteins, about 80 amino acids in length, in which the eight invariant residues include three His residues and two Cys residues. Two pairs of these invariant residues occur in motifs HxH (where x is A or G) and CxH, both of which suggest metal-binding activity. This protein family was identified by searching with a phylogenetic profile based on an anaerobic sulphatase-maturase enzyme, which contains multiple 4Fe-4S clusters. The linkages by phylogenetic profiling and by iron-sulphur cluster-related motifs together suggest this protein may be an accessory protein to certain maturases in sulphatase/maturase systems. 
Probab=21.33  E-value=44  Score=25.32  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=11.9

Q ss_pred             ccccCCHHHHHHHH
Q 036217           25 LESVHSPEAFEMIQ   38 (196)
Q Consensus        25 LEsiHS~EalEMI~   38 (196)
                      +++||..|+|+|.-
T Consensus         1 m~siHgHeVL~mmi   14 (78)
T PF10678_consen    1 MNSIHGHEVLNMMI   14 (78)
T ss_pred             CCccHHHHHHHHHH
Confidence            36899999999983


No 24 
>COG3750 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.38  E-value=1.3e+02  Score=23.38  Aligned_cols=27  Identities=11%  Similarity=0.176  Sum_probs=23.9

Q ss_pred             hccCHHHHHHHHhhhhHHHHHHHHHhh
Q 036217          108 MYLDAETLQRYATIRSKEAISLIEKQT  134 (196)
Q Consensus       108 m~FD~eTLqr~A~iRSkEav~lIEkht  134 (196)
                      ++||.+.+..|-++|-+.+-...|..+
T Consensus        47 ~GFDvKa~r~iirlrK~D~~er~EedA   73 (85)
T COG3750          47 HGFDVKAVRTIIRLRKLDKAERQEEDA   73 (85)
T ss_pred             CCccHHHHHHHHHHHhhhHHHHHHHHH
Confidence            589999999999999999998888643


Done!