Citrus Sinensis ID: 036315

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450--

MAAVSFKNRCTVKPAEPTYNGILPLSELDQIGTITHIPTIYFYQQPSENWLNPSDKVFKTLKDSLSFALVHFYPLAGRLRWIGRGRLELECNAAGVELVEAESRAKLEDLGDLSPRPEYNYLVPAVDYTLPIQELPLVLVQLTRFQCGGISLSFTISHAVADGPSALHFIFEWARIARREPLGLPPFLDRKVLQAGEPPVSYPLLDHAEFDHPPLLIGQTDNIEERKKKTTVCMLKLSETQVKKLKNMANEGHCNDIGHPFSRYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSGELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDLHALGGDEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLILPNPNEDGGLIVALCLQVCHMEAFKKHFYEDII

cccEEEECcEEECcccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHcccccccccEEEEcccccEEEEEccccEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEEcccCEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccccCCccccccEEEECHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccHHHHHHHHHHHHHHcc

*AAVSFKNRCTVKPAEPTYNGILPLSELDQIGTITHIPTIYFYQQPSENWLNPSDKVFKTLKDSLSFALVHFYPLAGRLRWIGRGRLELECNAAGVELVEAESRAKLEDLGDLSPRPEYNYLVPAVDYTLPIQELPLVLVQLTRFQCGGISLSFTISHAVADGPSALHFIFEWARIARREPLGLPPFLDRKVLQAGEPPVSYPLLDHAEFDHPPLLIGQTDN*EERKKKTTVCMLKLSETQVKKLKNMANEGHCNDIGHPFSRYETVTGHLWRCACKARGHKAEQTTALGVCVDSRSRMQPPLPLGYFGNATLDVIALSRSGELVSKPLGYASSKIRRAIVSVTEEYVRSGIEYLKNQPDLTKFQDLHALGGDEGPFYGNPNLGVVSWLTLPIYGLDFGWGKEIHMGPGTHDFDGDSLILPNPNEDGGLIVALCLQVCHMEAFKKHFYEDII

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Spermidine hydroxycinnamoyl transferase	Hydroxycinnamoyl transferase involved in the conjugation of feruloyl CoA to spermidine. Able to perform all three conjugating steps required for the biosynthesis of N1,N5,N10-triferuloyl-spermidine. Spermidine is the only acceptor substrate while feruloyl CoA > caffeoyl CoA > coumaroyl CoA > cinnamoyl CoA >> sinapoyl CoA are efficient acyl donors. No activity with hydroxyferuloyl CoA.	probable	O64470

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G22, chain A
Confidence level:very confident
Coverage over the Query: 3-214,229-449
View the alignment between query and template
View the model in PyMOL