Citrus Sinensis ID: 036334


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650----
MGGALMRLICFLLLSCGGGIGYVNSEPTQDKQALLAFLSRTPHKNRVQWNASDSACNWVGVECDANRSFVYSLRLPGVGLVGPIPPNTLGKLSQLRVLSLRSNRLSGEIPSDFSNLTLLRSLYLQSNQFSGVFPASVTRMNRLTRLDLSSNNFSGKIPFDVNNLTHLTGLFLENNKFSGNLPSINPANLRDFNVSNNNLNGSIPATLSKFPQSSFTGNLDLCGGPLPPCNPFFPSPAPSPSLPPPVAPVHKKSNKLSTAAIVGIAVGGAVFIVLLLLLLLFCLKKRRRQRPGKAPKPPAAATARAVTMEAGTSSSKDDITGGAAEADRNKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKEVAVGKREFEMQMEVLGKIKHDNVVPLRAFYYSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHVSGKIVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIENMNRGETDDGLRQSSDDPSKGSDGHTPPPESRTPPTALTP
cHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccEEECccccEEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccccEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccccccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHcccccccccccEEEEEcccCEEEEEcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccCEEcccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccHHHccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
**GALMRLICFLLLSCGGGIGYVNSEPTQDKQALLAFLSRTPHKNRVQWNASDSACNWVGVECDANRSFVYSLRLPGVGLVGPIPPNTLGKLSQLRVLSLRSNRLSGEIPSDFSNLTLLRSLYLQSNQFSGVFPASVTRMNRLTRLDLSSNNFSGKIPFDVNNLTHLTGLFLENNKFSGNLPSINPANLRDFNVSNNNLNGSIPATLSKFPQSSFTGNLDLCGGPL******************************STAAIVGIAVGGAVFIVLLLLLLLFCLKK*******************************************NKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKEVAVGKREFEMQMEVLGKIKHDNVVPLRAFYYSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHVSGKIVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMI*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGALMRLICFLLLSCGGGIGYVNSEPTQDKQALLAFLSRTPHKNRVQWNASDSACNWVGVECDANRSFVYSLRLPGVGLVGPIPPNTLGKLSQLRVLSLRSNRLSGEIPSDFSNLTLLRSLYLQSNQFSGVFPASVTRMNRLTRLDLSSNNFSGKIPFDVNNLTHLTGLFLENNKFSGNLPSINPANLRDFNVSNNNLNGSIPATLSKFPQSSFTGNLDLCGGPLPPCNPFFPSPAPSPSLPPPVAPVHKKSNKLSTAAIVGIAVGGAVFIVLLLLLLLFCLKKRRRQRPGKAPKPPAAATARAVTMEAGTSSSKDDITGGAAEADRNKLVFFEGGVYSFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKEVAVGKREFEMQMEVLGKIKHDNVVPLRAFYYSKDEKLLVYDYMPAGSLSALLHGSRGSGRTPLDWDNRMRIALSAARGLAHLHVSGKIVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVELMRYHNIEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIENMNRGETDDGLRQSSDDPSKGSDGHTPPPESRTPPTALTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive receptor kinase At2g26730 confidentO48788

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 56-208
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 26-214
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 351-619
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 361-564,577-638
View the alignment between query and template
View the model in PyMOL
Template: 3HGK, chain A
Confidence level:confident
Coverage over the Query: 331-614
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 73-213
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 255-261
View the alignment between query and template
View the model in PyMOL