BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036367
         (198 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q6BTC0|CYM1_DEBHA Mitochondrial presequence protease OS=Debaryomyces hansenii (strain
           ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
           GN=CYM1 PE=3 SV=2
          Length = 1063

 Score = 31.2 bits (69), Expect = 4.7,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 133 IRLSNGEFGDGFAEDGGAGCGEFEIHYQEP-PESYFGKFKRNWALHFGFLI 182
           IR +NG +G G + DG  GC  F   Y++P P +    FK + ++  G +I
Sbjct: 912 IREANGAYGGGLSFDGLGGCLNF-YSYRDPNPLTSVQSFKDSTSVALGKMI 961


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.329    0.142    0.452 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,484,155
Number of Sequences: 539616
Number of extensions: 2988901
Number of successful extensions: 12138
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 12116
Number of HSP's gapped (non-prelim): 20
length of query: 198
length of database: 191,569,459
effective HSP length: 111
effective length of query: 87
effective length of database: 131,672,083
effective search space: 11455471221
effective search space used: 11455471221
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 58 (26.9 bits)