Citrus Sinensis ID: 036425


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MVISVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKILNKEHEKTEDAKPTAVPTASSS
cCEEECccccccccccEEEcHHHHHHHHHHHHHccccccEEEEECcccccccccHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEEEcccccccccccEEEEEccccccccHHHHHHHHHHcccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
MVISVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKIL*********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISVPFEEDDKDPGIWFLDHNYHESMYSMFKRINAKEHVVGWYSTGPKLRENDLDIHQLFHNYVPNPVLVIIDVQPKELGIPTKAYYDVEEVKENATQKSQKVFVHVPSEIAAHEVEEIGVEHLLRDVKDTTISTLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKILNKEHEKTEDAKPTAVPTASSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 26S proteasome non-ATPase regulatory subunit 7 Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentO24412
26S proteasome non-ATPase regulatory subunit 7 Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.probableP51665
26S proteasome non-ATPase regulatory subunit 7 Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Plays an essential role during mouse embryonic development.probableP26516

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O95, chain A
Confidence level:very confident
Coverage over the Query: 2-134
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain U
Confidence level:very confident
Coverage over the Query: 2-165
View the alignment between query and template
View the model in PyMOL