BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036462
         (390 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2NR9|A Chain A, Crystal Structure Of Glpg, Rhomboid Peptidase From
           Haemophilus Influenzae
 pdb|3ODJ|A Chain A, Crystal Structure Of H. Influenzae Rhomboid Glpg With
           Disordered Loop 4, Helix 5 And Loop 5
          Length = 196

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 169 QVWRLLTCIWLHGGVFHVLANMLSLLFIGIRLEQEFGFVRIGFLYVLS 216
           +VWR ++   +H    H+L N+      G  +E+ FG V++  LYV++
Sbjct: 49  EVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVA 96


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.142    0.470 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,504,931
Number of Sequences: 62578
Number of extensions: 266705
Number of successful extensions: 574
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 562
Number of HSP's gapped (non-prelim): 12
length of query: 390
length of database: 14,973,337
effective HSP length: 101
effective length of query: 289
effective length of database: 8,652,959
effective search space: 2500705151
effective search space used: 2500705151
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)