BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036516
         (709 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CLY|H Chain H, Igg Fab (Human Igg1, Kappa) Chimeric Fragment (Cbr96)
           Complexed With Lewis Y Nonoate Methyl Ester
 pdb|1UCB|H Chain H, Structure Of Uncomplexed Fab Compared To Complex (1cly,
           1clz)
          Length = 219

 Score = 28.9 bits (63), Expect = 10.0,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 299 SLFFGMSFLKASCLALIMCCRGIAEIAVYCMWKDRKIIT 337
           SL+  MS LK+   A+  C RG+ + A +  W    ++T
Sbjct: 78  SLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVT 116


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,582,397
Number of Sequences: 62578
Number of extensions: 649769
Number of successful extensions: 1428
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1428
Number of HSP's gapped (non-prelim): 3
length of query: 709
length of database: 14,973,337
effective HSP length: 106
effective length of query: 603
effective length of database: 8,340,069
effective search space: 5029061607
effective search space used: 5029061607
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)