BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 036516
(709 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CLY|H Chain H, Igg Fab (Human Igg1, Kappa) Chimeric Fragment (Cbr96)
Complexed With Lewis Y Nonoate Methyl Ester
pdb|1UCB|H Chain H, Structure Of Uncomplexed Fab Compared To Complex (1cly,
1clz)
Length = 219
Score = 28.9 bits (63), Expect = 10.0, Method: Composition-based stats.
Identities = 13/39 (33%), Positives = 21/39 (53%)
Query: 299 SLFFGMSFLKASCLALIMCCRGIAEIAVYCMWKDRKIIT 337
SL+ MS LK+ A+ C RG+ + A + W ++T
Sbjct: 78 SLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVT 116
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.139 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,582,397
Number of Sequences: 62578
Number of extensions: 649769
Number of successful extensions: 1428
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1428
Number of HSP's gapped (non-prelim): 3
length of query: 709
length of database: 14,973,337
effective HSP length: 106
effective length of query: 603
effective length of database: 8,340,069
effective search space: 5029061607
effective search space used: 5029061607
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)