BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036522
         (70 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3Q6B|A Chain A, The High-Resolution And New Form Crystal Structure Of Bama
           Potra4-5 From E.Coli
          Length = 189

 Score = 26.2 bits (56), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 6/56 (10%)

Query: 18  ALISREMRNEK---MEKPNVSFGQAAQSRKGEDYF-LIKTDCQRVPGNPSSTFSVF 69
           A++ REMR  +   +    V  G+   +R G  +F  + TD QRVPG+P     V+
Sbjct: 132 AVLRREMRQMEGAWLGSDLVDQGKERLNRLG--FFETVDTDTQRVPGSPDQVDVVY 185


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.131    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,111,778
Number of Sequences: 62578
Number of extensions: 58561
Number of successful extensions: 173
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 171
Number of HSP's gapped (non-prelim): 4
length of query: 70
length of database: 14,973,337
effective HSP length: 40
effective length of query: 30
effective length of database: 12,470,217
effective search space: 374106510
effective search space used: 374106510
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)