Citrus Sinensis ID: 036537

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MRFNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
ccccccccccccccccccccccccccEEEEEEEcccccccccccEEEEEcccccccccccccccccccccccEEEcccccEEEEEEEEccccEEEEEEEEccccccccccEEEccccccccccEEEEEEEccccccEEEEEEEEEEcccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccc
ccccccHHHHEEEEEccccccccccEEEEEEEEccccccccccccEEEEEcccEEcccccccEEcccccEEEEEEEccccEEEEEEEccccEEEEEEEcccccccccEEEEEEcccHHccccEEEEEEccccccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccc
mrfncrytrldgcytaslclHGVKVSLLAVEMdtyknpfdpdtnhigldttsaESVATKCMFGWKKCLSSAginlksgrpikvQIYYDGLTKMLYVYMAYSGDQlqksmekpiimsetvpssvyVGFTaatgelseshqlldwtfttfplpsysprkQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGfykrikipphnfhlaingyd
MRFNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSsaginlksgrpIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
MRFNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
**FNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAIN***
****CRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTF*******************AATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGY*
MRFNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
**FNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFNCRYTRLDGCYTASLCLHGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTFPLPSYSPRKQYLLIMIAATKINIVGLLCKMCTCVEMIFVLYMYGFYKRIKIPPHNFHLAINGYD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query212 2.2.26 [Sep-21-2011]
P93538270 Bark lectin (Fragment) OS N/A no 0.514 0.403 0.338 5e-13
P93535292 Seed lectin OS=Styphnolob N/A no 0.514 0.373 0.338 1e-12
Q39527290 Lectin-related protein (F N/A no 0.514 0.375 0.330 2e-11
P22970244 Anti-H(O) lectin 1 OS=Cyt N/A no 0.514 0.446 0.338 3e-11
Q9LSR9 657 L-type lectin-domain cont yes no 0.551 0.178 0.365 3e-11
Q9FHG4 681 Probable L-type lectin-do no no 0.561 0.174 0.338 6e-11
O24313242 Basic agglutinin OS=Psoph N/A no 0.509 0.446 0.330 8e-11
P23558250 Lectin 1 OS=Laburnum alpi N/A no 0.514 0.436 0.333 8e-11
Q9SR87 693 Probable L-type lectin-do no no 0.561 0.171 0.343 1e-10
Q41160272 Putative bark agglutinin N/A no 0.509 0.397 0.338 1e-10
>sp|P93538|LECB_STYJP Bark lectin (Fragment) OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 64/124 (51%), Gaps = 15/124 (12%)

Query: 27  LLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIY 86
           ++AVE DT+ N +DP+T HIG+D  S +S  T   +GW+            G    V I 
Sbjct: 137 IVAVEFDTHTNAWDPNTRHIGIDVNSVKSTKT-VTWGWEN-----------GEVANVLIT 184

Query: 87  YDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATG---ELSESHQLLDW 143
           Y   T+ML V + Y  +Q    +   + +   +P  V VGFTA TG   +  E++ +L W
Sbjct: 185 YQAATEMLTVSLTYPSNQTSYILSAAVDLKSILPEWVRVGFTATTGLTTQYVETNDVLSW 244

Query: 144 TFTT 147
           +FT+
Sbjct: 245 SFTS 248
GalNAc-specific lectin.
Styphnolobium japonicum (taxid: 3897)
>sp|P93535|LECS_STYJP Seed lectin OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|Q39527|LECR_CLAKE Lectin-related protein (Fragment) OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|P22970|LEC1_CYTSE Anti-H(O) lectin 1 OS=Cytisus sessilifolius PE=1 SV=2 Back     alignment and function description
>sp|Q9LSR9|LRK18_ARATH L-type lectin-domain containing receptor kinase I.8 OS=Arabidopsis thaliana GN=LECRK18 PE=2 SV=1 Back     alignment and function description
>sp|Q9FHG4|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7 OS=Arabidopsis thaliana GN=LECRKS7 PE=2 SV=1 Back     alignment and function description
>sp|O24313|LEC1_PSOTE Basic agglutinin OS=Psophocarpus tetragonolobus GN=WBAI PE=1 SV=1 Back     alignment and function description
>sp|P23558|LEC1_LABAL Lectin 1 OS=Laburnum alpinum PE=1 SV=1 Back     alignment and function description
>sp|Q9SR87|LRK61_ARATH Probable L-type lectin-domain containing receptor kinase VI.1 OS=Arabidopsis thaliana GN=LECRK61 PE=2 SV=1 Back     alignment and function description
>sp|Q41160|LCB3_ROBPS Putative bark agglutinin LECRPA3 (Fragment) OS=Robinia pseudoacacia PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
359476128 661 PREDICTED: probable L-type lectin-domain 0.745 0.239 0.433 9e-31
296082025 569 unnamed protein product [Vitis vinifera] 0.740 0.275 0.436 9e-31
11596188268 lectin-related protein precursor [Citrus 0.617 0.488 0.457 7e-26
255548946 584 conserved hypothetical protein [Ricinus 0.674 0.244 0.451 1e-23
356566149276 PREDICTED: agglutinin-2-like [Glycine ma 0.594 0.456 0.316 6e-15
115440305 696 Os01g0779300 [Oryza sativa Japonica Grou 0.523 0.159 0.373 1e-14
125527932 612 hypothetical protein OsI_03974 [Oryza sa 0.523 0.181 0.373 3e-14
356566145 679 PREDICTED: L-type lectin-domain containi 0.778 0.243 0.281 4e-14
242054595 680 hypothetical protein SORBIDRAFT_03g03637 0.566 0.176 0.354 8e-14
356523924 700 PREDICTED: L-type lectin-domain containi 0.783 0.237 0.276 1e-13
>gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  139 bits (349), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 15/173 (8%)

Query: 21  HGVKVSLLAVEMDTYKNPFDPDTNHIGLDTTS-AESVATKCMFGWKKCLSSAGINLKSGR 79
            G  V  LAVE+DTY N FDPD NHIG+DTTS A  +A K        LS  G++LKSGR
Sbjct: 139 EGGVVRQLAVELDTYMNEFDPDANHIGIDTTSIAIPIAAKS-------LSGTGVDLKSGR 191

Query: 80  PIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQ 139
            +KV+I YDG  + L++ + Y+G+ L   +   I +S+TVPSSVYVGFT +TG +SE+HQ
Sbjct: 192 EVKVKIDYDGWRETLHISVGYAGNPLLSFLNHSIALSDTVPSSVYVGFTGSTGTVSETHQ 251

Query: 140 LLDWTFTTFPLPSYSPR-------KQYLLIMIAATKINIVGLLCKMCTCVEMI 185
           +LDW FT+ P+   S +       K  L+I+   T   +V ++C + + + ++
Sbjct: 252 VLDWAFTSIPITCSSSKCSGNDKTKTILIIVFPVTVAMLVLVMCGILSVLRVV 304

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296082025|emb|CBI21030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|11596188|gb|AAG38522.1|AF283537_1 lectin-related protein precursor [Citrus x paradisi] Back     alignment and taxonomy information
>gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356566149|ref|XP_003551297.1| PREDICTED: agglutinin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|115440305|ref|NP_001044432.1| Os01g0779300 [Oryza sativa Japonica Group] gi|15289871|dbj|BAB63567.1| putative lectin-like receptor kinase 1;1 [Oryza sativa Japonica Group] gi|113533963|dbj|BAF06346.1| Os01g0779300 [Oryza sativa Japonica Group] gi|215768375|dbj|BAH00604.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125527932|gb|EAY76046.1| hypothetical protein OsI_03974 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|356566145|ref|XP_003551295.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|242054595|ref|XP_002456443.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] gi|241928418|gb|EES01563.1| hypothetical protein SORBIDRAFT_03g036370 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356523924|ref|XP_003530584.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
TAIR|locus:2025037258 AT1G07460 [Arabidopsis thalian 0.561 0.461 0.341 5.6e-13
TAIR|locus:2144025 657 AT5G60280 [Arabidopsis thalian 0.551 0.178 0.365 1.6e-12
TAIR|locus:2144045 766 LecRK-I.9 "lectin receptor kin 0.646 0.178 0.358 1.9e-11
TAIR|locus:2144055 616 AT5G60310 [Arabidopsis thalian 0.768 0.264 0.335 4.7e-11
TAIR|locus:2162212 681 AT5G55830 [Arabidopsis thalian 0.561 0.174 0.338 5.4e-11
TAIR|locus:2040681 675 RLK "receptor lectin kinase" [ 0.561 0.176 0.317 1.1e-10
TAIR|locus:2078337 664 AT3G45410 [Arabidopsis thalian 0.556 0.177 0.352 1.4e-10
TAIR|locus:2097613 693 AT3G08870 [Arabidopsis thalian 0.561 0.171 0.351 1.5e-10
TAIR|locus:2043127 623 AT2G29250 [Arabidopsis thalian 0.566 0.192 0.328 2.7e-10
TAIR|locus:2133229 674 LPK1 "lectin-like protein kina 0.556 0.175 0.322 4e-09
TAIR|locus:2025037 AT1G07460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 43/126 (34%), Positives = 71/126 (56%)

Query:    27 LLAVEMDTYK-NPF-DPDTNHIGLDTTSAESV-ATKCMFGWKKCLSSAGINLKSGRPIKV 83
             +LAVE DT K N F D D NH+G+D     SV +    F   K   +  + L S  PI+ 
Sbjct:    73 ILAVEFDTVKSNEFLDIDDNHVGIDVNGLVSVESAPAAFFSNKQSKNISLKLSSKDPIRA 132

Query:    84 QIYYDGLTKMLYVYMAYSGDQLQKS---MEKPIIMSETVPSSVYVGFTAATGELSESHQL 140
              I Y+G+ ++L V +A + D  + +   + + + +SE     +YVGF+A+TG ++ +H +
Sbjct:   133 WIEYNGVERLLNVTLA-TLDTSKPNFPLLSRQMNLSEIFMEKMYVGFSASTGNITSNHDV 191

Query:   141 LDWTFT 146
             L W+F+
Sbjct:   192 LGWSFS 197
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0030246 "carbohydrate binding" evidence=ISS
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144045 LecRK-I.9 "lectin receptor kinase I.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144055 AT5G60310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040681 RLK "receptor lectin kinase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078337 AT3G45410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097613 AT3G08870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043127 AT2G29250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133229 LPK1 "lectin-like protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032635001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (599 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 4e-35
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 1e-33
cd01951223 cd01951, lectin_L-type, legume lectins 1e-18
cd07308218 cd07308, lectin_leg-like, legume-like lectins: ERG 0.004
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
 Score =  123 bits (312), Expect = 4e-35
 Identities = 51/130 (39%), Positives = 75/130 (57%), Gaps = 17/130 (13%)

Query: 26  SLLAVEMDTYKNPF--DPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKV 83
            ++AVE DT++NP   DPD NH+G+D  S  SV               G  LKSG+P++ 
Sbjct: 116 HIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGY-------WDDDGGKLKSGKPMQA 168

Query: 84  QIYYDGLTKMLYVYMAYSGDQLQKSMEKPII-----MSETVPSSVYVGFTAATGELSESH 138
            I YD  +K L V +AYSG       +KP++     +S+ +P  VYVGF+A+TG L+E H
Sbjct: 169 WIDYDSSSKRLSVTLAYSGV---AKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELH 225

Query: 139 QLLDWTFTTF 148
            +L W+F++ 
Sbjct: 226 YILSWSFSSN 235

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information
>gnl|CDD|173892 cd07308, lectin_leg-like, legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.95
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 98.95
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 98.66
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 97.54
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 97.39
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 97.26
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 96.64
KOG3839351 consensus Lectin VIP36, involved in the transport 93.48
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 91.56
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 85.15
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=100.00  E-value=5e-36  Score=258.74  Aligned_cols=133  Identities=39%  Similarity=0.671  Sum_probs=117.1

Q ss_pred             CCCCCeeeeeccCC---CCccEEEEEEeCCCC-CC-CCCCCeeEEecCCCCccccccccccccCCCCCccccCCCCcEEE
Q 036537            9 RLDGCYTASLCLHG---VKVSLLAVEMDTYKN-PF-DPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKV   83 (212)
Q Consensus         9 ~~~g~yLGL~~~~~---~~~~~vAVEFDT~~n-~~-Dp~~nHVgIdvns~~S~~t~~~~~y~~~~~~~~~~l~~G~~~~v   83 (212)
                      ++.|+||||++.++   ..++.+||||||++| ++ ||+.||||||+|++.|..+.   .|.    ...+.|.+|+.++|
T Consensus        96 ~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S~~~~---~~~----~~~~~l~~g~~~~v  168 (236)
T cd06899          96 ASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAG---YWD----DDGGKLKSGKPMQA  168 (236)
T ss_pred             CCCcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEEEcCCcccceee---ccc----cccccccCCCeEEE
Confidence            57899999998764   467899999999999 66 99999999999998777654   111    11345789999999


Q ss_pred             EEEEeCCccEEEEEEEEC--CCCcceeeeeeecCCCCCCCeEEEEEEeecCCcccceEEEeEEEEec
Q 036537           84 QIYYDGLTKMLYVYMAYS--GDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWTFTTF  148 (212)
Q Consensus        84 wI~Yd~~s~~L~V~l~~~--~kp~~plLs~~vdLs~~l~~~v~VGFSASTG~~~q~h~I~sWsF~s~  148 (212)
                      ||+||+.+++|+|+|+..  .+|..|+|++++||+.+|+++||||||||||...|.|+|++|+|+++
T Consensus       169 ~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         169 WIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             EEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            999999999999999984  37999999999999999999999999999999999999999999986

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 6e-12
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 6e-12
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 6e-12
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 1e-11
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 2e-11
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 7e-11
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 8e-11
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-10
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 1e-10
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 1e-10
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 3e-10
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 6e-10
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 8e-10
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 8e-10
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 8e-10
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 8e-10
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 8e-10
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 9e-10
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-09
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-09
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-09
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 1e-09
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 1e-09
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 2e-09
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 2e-09
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 2e-09
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 2e-09
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 3e-09
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 3e-09
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 4e-09
3a0k_A237 Crystal Structure Of An Antiflamatory Legume Lectin 6e-09
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-09
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-09
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 9e-09
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 9e-09
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 9e-09
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 9e-09
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 9e-09
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 1e-08
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 1e-08
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 1e-08
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 1e-08
2eig_A234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 1e-08
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 2e-08
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 2e-08
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 2e-08
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 2e-08
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 2e-08
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 3e-08
2cna_A237 The Covalent And Three-Dimensional Structure Of Con 3e-08
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 4e-08
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 5e-08
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 7e-08
2ctv_A237 High Resolution Crystallographic Studies Of Native 7e-08
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 8e-08
1fx5_A242 Crystal Structure Analysis Of Ulex Europaeus Lectin 8e-08
2pel_A236 Peanut Lectin Length = 236 2e-07
1bzw_A232 Peanut Lectin Complexed With C-Lactose Length = 232 2e-07
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 4e-07
1fat_A252 Phytohemagglutinin-L Length = 252 4e-07
1avb_A226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 2e-06
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 3e-05
1ioa_A240 Arcelin-5, A Lectin-Like Defense Protein From Phase 3e-05
1gsl_A243 Lectin (Fourth Isolated From (Griffonia Simplicifol 2e-04
1lgc_A181 Interaction Of A Legume Lectin With The N2 Fragment 6e-04
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 19/127 (14%)
Query: 27  LLAVEMDTYKNPFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQIY 86
            +AVE DT++N +DP   HIG+D  S  S  T         L + GI         V I 
Sbjct: 118 FVAVEFDTFRNTWDPQIPHIGIDVNSVISTKTVPF-----TLDNGGI-------ANVVIK 165
Query: 87  YDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELS-------ESHQ 139
           YD  TK+L+V + +       ++   + + + +P SV VGF+AATG+ S       E+H 
Sbjct: 166 YDASTKILHVVLVFPSLGTIYTIADIVDLKQVLPESVNVGFSAATGDPSGKQRNATETHD 225
Query: 140 LLDWTFT 146
           +L W+F+
Sbjct: 226 ILSWSFS 232
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|1IOA|A Chain A, Arcelin-5, A Lectin-Like Defense Protein From Phaseolus Vulgaris Length = 240 Back     alignment and structure
>pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 Back     alignment and structure
>pdb|1LGC|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 5e-28
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 1e-26
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 2e-26
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 7e-26
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 1e-25
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 3e-25
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 1e-24
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 1e-24
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 1e-24
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 2e-24
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 3e-24
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 3e-24
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 4e-24
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 5e-24
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 1e-23
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 6e-23
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 8e-23
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 1e-22
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 2e-22
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 7e-22
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 3e-21
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 6e-21
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 1e-20
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 5e-20
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 5e-13
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 2e-11
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 7e-10
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 6e-08
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
 Score =  101 bits (253), Expect = 5e-28
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 16/134 (11%)

Query: 27  LLAVEMDTYKNP--FDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQ 84
           ++AVE DTY NP   DP+  HIG+D  S  S  T               + ++G+     
Sbjct: 3   VVAVEFDTYLNPDYGDPNYIHIGIDVNSIRSKVTAKW------------DWQNGKIATAH 50

Query: 85  IYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDWT 144
           I Y+ ++K L V   Y+G +   ++   I +   +P  V VG +A+TG+  E + +  W+
Sbjct: 51  ISYNSVSKRLSVTSYYAGSKPA-TLSYDIELHTVLPEWVRVGLSASTGQDKERNTVHSWS 109

Query: 145 FTTFPLPSYSPRKQ 158
           FT+  L +   +K+
Sbjct: 110 FTSS-LWTNVAKKE 122
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 99.97
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.9
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.86
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.86
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.59
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.52
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.72
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 97.36
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
Probab=100.00  E-value=9.7e-41  Score=294.07  Aligned_cols=134  Identities=27%  Similarity=0.432  Sum_probs=121.3

Q ss_pred             cCCCCCeeeeeccCC--CCccEEEEEEeCCCC-CCCCCCCeeEEecCCCCccccccccccccCCCCCccccCCCCcEEEE
Q 036537            8 TRLDGCYTASLCLHG--VKVSLLAVEMDTYKN-PFDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKVQ   84 (212)
Q Consensus         8 ~~~~g~yLGL~~~~~--~~~~~vAVEFDT~~n-~~Dp~~nHVgIdvns~~S~~t~~~~~y~~~~~~~~~~l~~G~~~~vw   84 (212)
                      .+++||||||||.++  +.+++|||||||++| +|||++|||||||||+.|.+++         ++   ++.+|+.++||
T Consensus       121 p~~~gg~LGL~n~~~~~~~n~~vAVEFDT~~N~e~Dp~~nHVGIDvNSi~S~~t~---------~~---~l~~G~~~~vw  188 (281)
T 3ujo_A          121 PKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTT---------SW---DFANGENAEVL  188 (281)
T ss_dssp             CCCCGGGTTTCSCSSCCTTSCCEEEEECCSCCCSSCCSSSEEEEEESSSCCSCEE---------EC---CCCSSCCEEEE
T ss_pred             CCCCcceeeeccccCCCccCcEEEEEEeccccccCCCCCCeEEEEcCCCCccccc---------cc---cccCCCEEEEE
Confidence            357899999998753  578899999999999 8999999999999999998887         44   46799999999


Q ss_pred             EEEeCCccEEEEEEEECCCCcceeeeeeecCCCCCCCeEEEEEEeecCC---cccceEEEeEEEEecCCCCC
Q 036537           85 IYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGE---LSESHQLLDWTFTTFPLPSY  153 (212)
Q Consensus        85 I~Yd~~s~~L~V~l~~~~kp~~plLs~~vdLs~~l~~~v~VGFSASTG~---~~q~h~I~sWsF~s~~~~~~  153 (212)
                      |+||+.+++|+|+|.+...|+.|+|++.+||+++|+|+||||||||||.   ..|.|+|++|+|++++++..
T Consensus       189 I~Yd~~tk~L~V~l~~~~~~~~~~lS~~vDL~~~L~e~v~VGFSAsTG~~~~~~e~H~IlsWSFss~l~~~~  260 (281)
T 3ujo_A          189 ITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINK  260 (281)
T ss_dssp             EEECTTTCEEEEEEECTTTCCCEEEEEECCSTTTSCSEEEEEEEEEECSSTTSCCCCEEEEEEEEEEECSSS
T ss_pred             EEEeCCCCEEEEEEecCCCCCCceEEEEechHHhccCcEEEEEEeecCCCCcccceeEEEEEEEEEEcCCCC
Confidence            9999999999999998666778999999999999999999999999996   58999999999999988653
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 212
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 9e-32
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 1e-30
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 1e-28
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 2e-28
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 4e-28
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-27
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 3e-27
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 8e-27
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 1e-26
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 1e-26
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 2e-26
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 4e-26
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-25
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 6e-24
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-23
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 4e-23
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 2e-22
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 3e-22
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-21
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 1e-20
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 5e-19
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 1e-17
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 2e-08
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 5e-06
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Concanavalin A
species: Jack bean (Canavalia ensiformis) [TaxId: 3823]

 Score =  113 bits (284), Expect = 9e-32
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 26  SLLAVEMDTYKNP--FDPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGRPIKV 83
           +++AVE+DTY N    DP   HIG+D  S  S  T            A  N+++G+    
Sbjct: 3   TIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKT------------AKWNMQNGKVGTA 50

Query: 84  QIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGELSESHQLLDW 143
            I Y+ + K L   ++Y       ++   + +   +P  V VG +A+TG   E++ +L W
Sbjct: 51  HIIYNSVDKRLSAVVSYPNADSA-TVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSW 109

Query: 144 TFTTFPLPSYSPRKQYLLIMIAATKIN 170
           +FT+    + +     L  M      +
Sbjct: 110 SFTSKLKSNSTHETNALHFMFNQFSKD 136
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.97
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.97
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.96
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.95
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.93
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.65
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 98.88
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 98.79
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]

Probab=100.00  E-value=7.9e-38  Score=267.04  Aligned_cols=134  Identities=31%  Similarity=0.474  Sum_probs=118.9

Q ss_pred             cccCCCCCeeeeeccCC----CCccEEEEEEeCCCC-CC-CCCCCeeEEecCCCCccccccccccccCCCCCccccCCCC
Q 036537            6 RYTRLDGCYTASLCLHG----VKVSLLAVEMDTYKN-PF-DPDTNHIGLDTTSAESVATKCMFGWKKCLSSAGINLKSGR   79 (212)
Q Consensus         6 ~~~~~~g~yLGL~~~~~----~~~~~vAVEFDT~~n-~~-Dp~~nHVgIdvns~~S~~t~~~~~y~~~~~~~~~~l~~G~   79 (212)
                      +-.++.|+||||++..+    ..++++||||||++| ++ ||++||||||+|++.|.++.         ++...++.+|+
T Consensus        96 ~~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIgIdvns~~s~~~~---------~~~~~~l~~G~  166 (236)
T d1hqla_          96 SDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATK---------RWEDSDIFSGK  166 (236)
T ss_dssp             CCCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEEEEESSSSCSEEE---------ECCHHHHTSCS
T ss_pred             CCCCCCccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEEEEcCCccccccc---------ccccccccCCC
Confidence            44578899999998753    357899999999999 66 99999999999999988776         45467899999


Q ss_pred             cEEEEEEEeCCccEEEEEEEECCCCcceeeeeeecCCCCCCCeEEEEEEeecCCc-ccceEEEeEEEEecC
Q 036537           80 PIKVQIYYDGLTKMLYVYMAYSGDQLQKSMEKPIIMSETVPSSVYVGFTAATGEL-SESHQLLDWTFTTFP  149 (212)
Q Consensus        80 ~~~vwI~Yd~~s~~L~V~l~~~~kp~~plLs~~vdLs~~l~~~v~VGFSASTG~~-~q~h~I~sWsF~s~~  149 (212)
                      .++|||+||+.+++|+|+|+.. +|..|+|++.|||+++|+++||||||||||.. .+.|+|++|+|++++
T Consensus       167 ~~~v~I~Yd~~~~~L~V~l~~~-~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~~h~I~sWsF~s~l  236 (236)
T d1hqla_         167 IATARISYDGSAEILTVVLSYP-DGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYILSWRFSSNL  236 (236)
T ss_dssp             CEEEEEEEETTTTEEEEEEEET-TTEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCEEEEEEEEEEEEEC
T ss_pred             EEEEEEEEeCCCcEEEEEEecC-CCCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCceEEEEEEeEeEecC
Confidence            9999999999999999999874 57789999999999999999999999999974 678999999999875
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure