Citrus Sinensis ID: 036579

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-

MDPTIYFTLLLFLLPLYLILRRKTSKQLPPGSFGLPIIGHSLSFLRAMHTDTVEQWFQRRIKKYGPIYKLSLFGTPGVFIHGQAANKFIYTCDSDTVVPHQPPSFKMICGERNILELNGEEHKRIRGALMSFLKPEVLKQYVGKMDEEIRKHLEIHWHGKQKIKVMPSMKTLTFNIMSSLLFGIEQGASRDALIELIQQISNGSVSLPINIPFTCFHRGLRARAKFRTMIMDLIKQRRAALKNETALPQQDLITCLLNIQNNDNSIILSDEEIVNNVIVLMIAGHDTSSILITFLVRLLANDPTVYATISKEQEEIAKNKASGELLTWNDLANMKYTWRVALETLRIYPPVYGAFKKVLKDFEYEGYTIPKGWQIVLASCMTHMDEQIFPDPSKFDPTRFEKQASIPPYSFVAFGGGPRICPGYEFARIETLTTIHYLVTKFTWKISCLDNFTRNPVPNFKQGLPIEIQPK

ccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHccccEEcccccccEEEECcHHHHHHHHHccccccccccccHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccCEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHcccHHHHHHHHHHHcccccccccccEEcccEEEccEECccccEEEcccHHHccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHccEEEECccccccccccccccccccEEEECc

xxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome P450 26A1	Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of 4-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA and 4-oxo-RA.	probable	P79739
Cytochrome P450 26A1	Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA.	probable	O43174

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CZH, chain A
Confidence level:very confident
Coverage over the Query: 40-471
View the alignment between query and template
View the model in PyMOL