BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036594
         (214 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ALA|A Chain A, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|B Chain B, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|C Chain C, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|D Chain D, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|E Chain E, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|F Chain F, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
 pdb|3ALA|G Chain G, Crystal Structure Of Vascular Adhesion Protein-1 In Space
           Group C2
          Length = 748

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 93  WICQGMRAMASDFASAEIQGEFSELRQRMGPGLTFVIEAQPYLNAI 138
           W   G   + +D +  E+      L QR+GPGL    +A+P  N +
Sbjct: 36  WTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCV 81


>pdb|2C10|A Chain A, The Structure Of A Truncated, Soluble Version Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C10|B Chain B, The Structure Of A Truncated, Soluble Version Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C10|C Chain C, The Structure Of A Truncated, Soluble Version Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C10|D Chain D, The Structure Of A Truncated, Soluble Version Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C11|A Chain A, Crystal Structure Of The 2-Hydrazinopyridine Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C11|B Chain B, Crystal Structure Of The 2-Hydrazinopyridine Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C11|C Chain C, Crystal Structure Of The 2-Hydrazinopyridine Of
           Semicarbazide-Sensitive Amine Oxidase
 pdb|2C11|D Chain D, Crystal Structure Of The 2-Hydrazinopyridine Of
           Semicarbazide-Sensitive Amine Oxidase
          Length = 735

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 93  WICQGMRAMASDFASAEIQGEFSELRQRMGPGLTFVIEAQPYLNAI 138
           W   G   + +D +  E+      L QR+GPGL    +A+P  N +
Sbjct: 23  WTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCV 68


>pdb|1US1|A Chain A, Crystal Structure Of Human Vascular Adhesion Protein-1
 pdb|1US1|B Chain B, Crystal Structure Of Human Vascular Adhesion Protein-1
 pdb|1PU4|A Chain A, Crystal Structure Of Human Vascular Adhesion Protein-1
 pdb|1PU4|B Chain B, Crystal Structure Of Human Vascular Adhesion Protein-1
 pdb|2Y73|A Chain A, The Native Structures Of Soluble Human Primary Amine
           Oxidase Aoc3
 pdb|2Y73|B Chain B, The Native Structures Of Soluble Human Primary Amine
           Oxidase Aoc3
 pdb|2Y74|A Chain A, The Crystal Structure Of Human Soluble Primary Amine
           Oxidase Aoc3 In The Off-Copper Conformation
 pdb|2Y74|B Chain B, The Crystal Structure Of Human Soluble Primary Amine
           Oxidase Aoc3 In The Off-Copper Conformation
          Length = 763

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 93  WICQGMRAMASDFASAEIQGEFSELRQRMGPGLTFVIEAQPYLNAI 138
           W   G   + +D +  E+      L QR+GPGL    +A+P  N +
Sbjct: 51  WTHPGQSQLFADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCV 96


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.132    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,684,029
Number of Sequences: 62578
Number of extensions: 169303
Number of successful extensions: 409
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 405
Number of HSP's gapped (non-prelim): 6
length of query: 214
length of database: 14,973,337
effective HSP length: 95
effective length of query: 119
effective length of database: 9,028,427
effective search space: 1074382813
effective search space used: 1074382813
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)