Query         036653
Match_columns 487
No_of_seqs    339 out of 1152
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 04:11:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036653.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036653hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03106 WRKY:  WRKY DNA -bindi 100.0 1.7E-30 3.6E-35  205.9   2.8   59  348-406     1-59  (60)
  2 smart00774 WRKY DNA binding do 100.0 2.3E-29 5.1E-34  199.1   5.2   58  348-405     1-59  (59)
  3 PF03106 WRKY:  WRKY DNA -bindi 100.0   3E-29 6.6E-34  198.7   4.8   59  173-231     1-60  (60)
  4 smart00774 WRKY DNA binding do  99.9 3.2E-28 6.9E-33  192.7   4.6   57  173-229     1-59  (59)
  5 PF04500 FLYWCH:  FLYWCH zinc f  92.3   0.092   2E-06   39.8   2.0   49  347-405    11-62  (62)
  6 PF04500 FLYWCH:  FLYWCH zinc f  91.7    0.17 3.7E-06   38.3   2.9   48  173-229    12-62  (62)
  7 PF03101 FAR1:  FAR1 DNA-bindin  88.1    0.59 1.3E-05   38.5   3.6   29  203-231    61-89  (91)
  8 PF03101 FAR1:  FAR1 DNA-bindin  85.2     0.7 1.5E-05   38.1   2.5   30  377-407    60-89  (91)
  9 PF09026 CENP-B_dimeris:  Centr  74.5    0.98 2.1E-05   40.1   0.0    8   32-39     31-38  (101)
 10 PTZ00415 transmission-blocking  60.8     3.1 6.6E-05   51.9   0.3   14  472-485   766-779 (2849)
 11 KOG1832 HIV-1 Vpr-binding prot  55.2     4.7  0.0001   47.7   0.6   29   10-38   1399-1427(1516)
 12 PF03859 CG-1:  CG-1 domain;  I  30.2      96  0.0021   28.6   4.7   75  327-401    30-116 (118)
 13 cd07691 Ig_CD3_gamma_delta Imm  24.4      89  0.0019   26.3   3.2   29  174-203    16-54  (69)
 14 PTZ00415 transmission-blocking  24.2      25 0.00054   44.6  -0.1   27   19-45    154-180 (2849)
 15 PLN03097 FHY3 Protein FAR-RED   22.8      85  0.0018   37.3   3.8   34  199-232   156-189 (846)
 16 PLN03097 FHY3 Protein FAR-RED   21.6      94   0.002   36.9   3.9   35  374-409   156-190 (846)

No 1  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.96  E-value=1.7e-30  Score=205.93  Aligned_cols=59  Identities=56%  Similarity=1.216  Sum_probs=52.6

Q ss_pred             cCCCcccccccccccCCCCCCCcccccccCCCCccceeeeccCCCCeEEEEEeeeccCC
Q 036653          348 SGDGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD  406 (487)
Q Consensus       348 ~dDGy~WRKYGQK~vkgn~~pRsYYrCt~~gC~arK~Ver~~~d~~~~~~tY~G~HnH~  406 (487)
                      ++|||+|||||||.|+|+++||+||||++.+|+|+|+|||+.+|+.+|+|||+|.|||+
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            58999999999999999999999999999999999999999999999999999999996


No 2  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.95  E-value=2.3e-29  Score=199.12  Aligned_cols=58  Identities=55%  Similarity=1.167  Sum_probs=56.5

Q ss_pred             cCCCcccccccccccCCCCCCCccccccc-CCCCccceeeeccCCCCeEEEEEeeeccC
Q 036653          348 SGDGYRWRKYGQKMVKGNPNPRNYYRCTS-AGCPVRKHIETAVDNTSAVIITYKGVHDH  405 (487)
Q Consensus       348 ~dDGy~WRKYGQK~vkgn~~pRsYYrCt~-~gC~arK~Ver~~~d~~~~~~tY~G~HnH  405 (487)
                      ++|||+|||||||.|+|+++||+||||++ +||+|+|+|||+.+|+.+++|||+|.|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            47999999999999999999999999999 89999999999999999999999999998


No 3  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.95  E-value=3e-29  Score=198.74  Aligned_cols=59  Identities=42%  Similarity=0.847  Sum_probs=49.5

Q ss_pred             CCCccccccccccccCCCCCCCceeeeeeCCeeeee-eEecCCCCcEEEEEeecCCCCCC
Q 036653          173 VSDGYNWRKYGQKQVKSPKGSRSYYKCTYSDCCAKK-IECSDHSGHVIEIVNKGMHSHDP  231 (487)
Q Consensus       173 ~~DGy~WRKYGQK~vkgs~~pRsYYrCt~~~C~akK-~~~~~~dg~~~~i~Y~G~HnH~~  231 (487)
                      ++|||+|||||||.|+|+++|||||||++.+|+|+| |++...|+.+++|+|+|+|||++
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~k   60 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHPK   60 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS--
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCCC
Confidence            589999999999999999999999999999999998 56666799999999999999974


No 4  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.94  E-value=3.2e-28  Score=192.66  Aligned_cols=57  Identities=51%  Similarity=0.987  Sum_probs=53.6

Q ss_pred             CCCccccccccccccCCCCCCCceeeeee-CCeeeee-eEecCCCCcEEEEEeecCCCC
Q 036653          173 VSDGYNWRKYGQKQVKSPKGSRSYYKCTY-SDCCAKK-IECSDHSGHVIEIVNKGMHSH  229 (487)
Q Consensus       173 ~~DGy~WRKYGQK~vkgs~~pRsYYrCt~-~~C~akK-~~~~~~dg~~~~i~Y~G~HnH  229 (487)
                      ++|||+|||||||.|+|+++||+|||||+ .+|+|+| |++.+.||.+++|+|+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            48999999999999999999999999999 8999988 666667999999999999998


No 5  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=92.28  E-value=0.092  Score=39.79  Aligned_cols=49  Identities=27%  Similarity=0.650  Sum_probs=26.2

Q ss_pred             ccCCCcccccccccccCCCCCCCcccccccC---CCCccceeeeccCCCCeEEEEEeeeccC
Q 036653          347 ISGDGYRWRKYGQKMVKGNPNPRNYYRCTSA---GCPVRKHIETAVDNTSAVIITYKGVHDH  405 (487)
Q Consensus       347 ~~dDGy~WRKYGQK~vkgn~~pRsYYrCt~~---gC~arK~Ver~~~d~~~~~~tY~G~HnH  405 (487)
                      ++-|||.-+++...      ....|++|+..   +|+|+=.+.  . +.. .++...+.|||
T Consensus        11 L~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~-~~~-~~~~~~~~HnH   62 (62)
T PF04500_consen   11 LVYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--A-GDG-RVVRTNGEHNH   62 (62)
T ss_dssp             EEETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE-----TT-EEEE-S---SS
T ss_pred             EEECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--C-CCC-EEEECCCccCC
Confidence            44599998776555      45789999953   899999995  2 232 44555599999


No 6  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=91.70  E-value=0.17  Score=38.33  Aligned_cols=48  Identities=27%  Similarity=0.622  Sum_probs=24.9

Q ss_pred             CCCccccccccccccCCCCCCCceeeeeeC---CeeeeeeEecCCCCcEEEEEeecCCCC
Q 036653          173 VSDGYNWRKYGQKQVKSPKGSRSYYKCTYS---DCCAKKIECSDHSGHVIEIVNKGMHSH  229 (487)
Q Consensus       173 ~~DGy~WRKYGQK~vkgs~~pRsYYrCt~~---~C~akK~~~~~~dg~~~~i~Y~G~HnH  229 (487)
                      .-|||.-+++...      ..+.|+||+..   +|.|+=+.. ..++ .+ +...++|||
T Consensus        12 ~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~-~~~~-~~-~~~~~~HnH   62 (62)
T PF04500_consen   12 VYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD-AGDG-RV-VRTNGEHNH   62 (62)
T ss_dssp             EETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE---TT-EE-EE-S---SS
T ss_pred             EECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE-CCCC-EE-EECCCccCC
Confidence            4688887776655      66789999987   799986554 3333 33 344599999


No 7  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=88.10  E-value=0.59  Score=38.51  Aligned_cols=29  Identities=17%  Similarity=0.029  Sum_probs=23.0

Q ss_pred             CeeeeeeEecCCCCcEEEEEeecCCCCCC
Q 036653          203 DCCAKKIECSDHSGHVIEIVNKGMHSHDP  231 (487)
Q Consensus       203 ~C~akK~~~~~~dg~~~~i~Y~G~HnH~~  231 (487)
                      +|+|+=.+....+|....+.+..+|||+.
T Consensus        61 gC~a~i~v~~~~~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   61 GCKARINVKRRKDGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             CCCEEEEEEEccCCEEEEEECcCCcCCCC
Confidence            79987544444489988899999999974


No 8  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=85.17  E-value=0.7  Score=38.08  Aligned_cols=30  Identities=17%  Similarity=0.410  Sum_probs=25.8

Q ss_pred             CCCCccceeeeccCCCCeEEEEEeeeccCCC
Q 036653          377 AGCPVRKHIETAVDNTSAVIITYKGVHDHDM  407 (487)
Q Consensus       377 ~gC~arK~Ver~~~d~~~~~~tY~G~HnH~~  407 (487)
                      .||+|+=.|-+.. +..-.++.+...|||++
T Consensus        60 tgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   60 TGCKARINVKRRK-DGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             cCCCEEEEEEEcc-CCEEEEEECcCCcCCCC
Confidence            6999999998876 55678889999999975


No 9  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=74.55  E-value=0.98  Score=40.09  Aligned_cols=8  Identities=50%  Similarity=0.593  Sum_probs=0.0

Q ss_pred             ccChhhhh
Q 036653           32 ILDDEEED   39 (487)
Q Consensus        32 ~~~~~~~~   39 (487)
                      |+||++|+
T Consensus        31 Dddddee~   38 (101)
T PF09026_consen   31 DDDDDEEE   38 (101)
T ss_dssp             --------
T ss_pred             cccccccc
Confidence            33333333


No 10 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=60.82  E-value=3.1  Score=51.86  Aligned_cols=14  Identities=36%  Similarity=0.562  Sum_probs=8.0

Q ss_pred             hhhhhhhhcceeec
Q 036653          472 ESARTLLSIGFEIK  485 (487)
Q Consensus       472 esartl~si~~~~~  485 (487)
                      .|.+.+++|-|-|-
T Consensus       766 ~s~~d~~~l~fqvP  779 (2849)
T PTZ00415        766 GSDEDLFSLQFQIP  779 (2849)
T ss_pred             CCCCCeEEEEEecC
Confidence            45566666666553


No 11 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=55.23  E-value=4.7  Score=47.69  Aligned_cols=29  Identities=34%  Similarity=0.633  Sum_probs=15.5

Q ss_pred             hhhccCCCCCchhhhhhhhhhhccChhhh
Q 036653           10 RKRHENPQNDEFEEEEEEEDEEILDDEEE   38 (487)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   38 (487)
                      |.|-..+.||+++++|+|+.+||+|+|++
T Consensus      1399 R~r~~~dd~DeeeD~e~Ed~dEddd~edd 1427 (1516)
T KOG1832|consen 1399 RRRPTDDDSDEEEDDETEDEDEDDDEEDD 1427 (1516)
T ss_pred             ccCCCccccCccccchhhccccccccccc
Confidence            44444566666666555555554444443


No 12 
>PF03859 CG-1:  CG-1 domain;  InterPro: IPR005559  CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=30.16  E-value=96  Score=28.62  Aligned_cols=75  Identities=20%  Similarity=0.241  Sum_probs=37.0

Q ss_pred             CCCCCCCCCceEEeecCCccccCCCccccc-cccccc---------CCCCCCCcccccccCCCCccceeeeccCCC--Ce
Q 036653          327 SFLKPGKKPKFVVHAAGDVGISGDGYRWRK-YGQKMV---------KGNPNPRNYYRCTSAGCPVRKHIETAVDNT--SA  394 (487)
Q Consensus       327 ~~~k~~~~~~~vv~t~sd~~~~dDGy~WRK-YGQK~v---------kgn~~pRsYYrCt~~gC~arK~Ver~~~d~--~~  394 (487)
                      ++.+|..+.-++.-..-....-.|||.||| =+-|.|         .|....-+||-=+..+=.+...+=+--+.+  .+
T Consensus        30 ~~~rP~sGslfLf~Rk~~r~fRkDG~~WrKkkdgktvRE~HekLKv~~~e~l~~~Yah~~~~~~F~RR~Ywll~~~~~~i  109 (118)
T PF03859_consen   30 PPNRPPSGSLFLFNRKVVRFFRKDGHNWRKKKDGKTVREDHEKLKVGGVEVLNCYYAHSEDNPTFHRRCYWLLDPPYEHI  109 (118)
T ss_pred             CCCCCCCceEEEEEchHhhhhhcccceeEEcCCCCchhhhhhhhccCceeeeEEEEEeeccCCCeeeEEEEccCCCCceE
Confidence            345555555555544333335689999995 233322         333444455543333333333333334433  46


Q ss_pred             EEEEEee
Q 036653          395 VIITYKG  401 (487)
Q Consensus       395 ~~~tY~G  401 (487)
                      +.|.|.-
T Consensus       110 VLVHY~~  116 (118)
T PF03859_consen  110 VLVHYLD  116 (118)
T ss_pred             EEEEeee
Confidence            6666643


No 13 
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=24.41  E-value=89  Score=26.32  Aligned_cols=29  Identities=24%  Similarity=0.642  Sum_probs=20.3

Q ss_pred             CCccccccccccccC--------C--CCCCCceeeeeeCC
Q 036653          174 SDGYNWRKYGQKQVK--------S--PKGSRSYYKCTYSD  203 (487)
Q Consensus       174 ~DGy~WRKYGQK~vk--------g--s~~pRsYYrCt~~~  203 (487)
                      +.-+.|-| |-..+.        |  ..-||+-|+|.-.+
T Consensus        16 ~tsi~W~k-G~~~~~~~~~tlnLGs~~~DPRG~Y~C~~s~   54 (69)
T cd07691          16 ATNITWKK-GKEILEVSNTLLDLGSRINDPRGTYSCKESE   54 (69)
T ss_pred             CCcEEEec-CcccccccccEEeccCcccCCCcceEecCcc
Confidence            35589999 764442        2  27899999995543


No 14 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=24.19  E-value=25  Score=44.60  Aligned_cols=27  Identities=41%  Similarity=0.735  Sum_probs=11.3

Q ss_pred             CchhhhhhhhhhhccChhhhhhcccCC
Q 036653           19 DEFEEEEEEEDEEILDDEEEDEGASQL   45 (487)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   45 (487)
                      |+++++|+|++++++|||||+|++.|+
T Consensus       154 d~~~~~~~~~~~~~~~~~e~~~~~~~~  180 (2849)
T PTZ00415        154 DDDDEDEDEDDDDEEDDEEEEEEEEEI  180 (2849)
T ss_pred             CCccccccccccccccccccccccccc
Confidence            444444444444444444444444433


No 15 
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=22.85  E-value=85  Score=37.26  Aligned_cols=34  Identities=21%  Similarity=0.226  Sum_probs=28.8

Q ss_pred             eeeCCeeeeeeEecCCCCcEEEEEeecCCCCCCC
Q 036653          199 CTYSDCCAKKIECSDHSGHVIEIVNKGMHSHDPP  232 (487)
Q Consensus       199 Ct~~~C~akK~~~~~~dg~~~~i~Y~G~HnH~~p  232 (487)
                      |+.-+|+|+=.+....+|....+-+..+|||+.-
T Consensus       156 ~tRtGC~A~m~Vk~~~~gkW~V~~fv~eHNH~L~  189 (846)
T PLN03097        156 CAKTDCKASMHVKRRPDGKWVIHSFVKEHNHELL  189 (846)
T ss_pred             ccCCCCceEEEEEEcCCCeEEEEEEecCCCCCCC
Confidence            7888999987666678899988999999999853


No 16 
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=21.63  E-value=94  Score=36.91  Aligned_cols=35  Identities=23%  Similarity=0.504  Sum_probs=29.4

Q ss_pred             cccCCCCccceeeeccCCCCeEEEEEeeeccCCCCC
Q 036653          374 CTSAGCPVRKHIETAVDNTSAVIITYKGVHDHDMPV  409 (487)
Q Consensus       374 Ct~~gC~arK~Ver~~~d~~~~~~tY~G~HnH~~P~  409 (487)
                      |+..||+|+=.|.+..+ ..-+++-+...|||+.-+
T Consensus       156 ~tRtGC~A~m~Vk~~~~-gkW~V~~fv~eHNH~L~p  190 (846)
T PLN03097        156 CAKTDCKASMHVKRRPD-GKWVIHSFVKEHNHELLP  190 (846)
T ss_pred             ccCCCCceEEEEEEcCC-CeEEEEEEecCCCCCCCC
Confidence            78889999999988554 468899999999998743


Done!