Query         036707
Match_columns 67
No_of_seqs    129 out of 1053
Neff          6.4 
Searched_HMMs 46136
Date          Fri Mar 29 04:40:25 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036707.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036707hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02367 lactoylglutathione ly  99.7 2.4E-16 5.1E-21  107.6   7.5   67    1-67     80-146 (233)
  2 PLN03042 Lactoylglutathione ly  99.5 4.6E-14 9.9E-19   93.0   7.2   67    1-67     32-98  (185)
  3 cd08358 Glo_EDI_BRP_like_21 Th  99.3 3.1E-12 6.7E-17   80.1   6.3   41    1-41      7-58  (127)
  4 KOG2944 Glyoxalase [Carbohydra  99.1   1E-11 2.2E-16   81.2   0.7   67    1-67     27-93  (170)
  5 PRK10291 glyoxalase I; Provisi  99.1 4.6E-10 9.9E-15   67.9   5.9   42    1-42      1-42  (129)
  6 KOG2943 Predicted glyoxalase [  98.9   7E-10 1.5E-14   77.1   3.0   44    2-45     23-77  (299)
  7 cd07241 Glo_EDI_BRP_like_3 Thi  98.7 4.6E-08   1E-12   57.4   4.9   41    1-41      6-46  (125)
  8 cd07233 Glyoxalase_I Glyoxalas  98.6   2E-07 4.3E-12   54.6   5.3   42    1-42      5-46  (121)
  9 TIGR00068 glyox_I lactoylgluta  98.5 2.7E-07 5.9E-12   57.3   5.7   42    1-42     22-63  (150)
 10 PLN02300 lactoylglutathione ly  98.5 2.4E-07 5.2E-12   63.4   5.8   42    1-42     29-70  (286)
 11 cd07243 2_3_CTD_C C-terminal d  98.5 3.2E-07 6.9E-12   57.2   5.7   41    1-41     11-52  (143)
 12 cd07257 THT_oxygenase_C The C-  98.5 3.1E-07 6.8E-12   57.7   4.9   42    1-42      6-48  (153)
 13 cd08355 Glo_EDI_BRP_like_14 Th  98.4 9.6E-07 2.1E-11   52.3   5.8   30    2-31      5-34  (122)
 14 PF00903 Glyoxalase:  Glyoxalas  98.4 1.1E-06 2.3E-11   51.2   5.7   42    1-42      6-49  (128)
 15 TIGR03645 glyox_marine lactoyl  98.4 5.5E-07 1.2E-11   57.2   4.7   25    1-25      9-33  (162)
 16 cd07246 Glo_EDI_BRP_like_8 Thi  98.4 1.5E-06 3.2E-11   50.8   5.8   30    2-31      7-36  (122)
 17 cd07256 HPCD_C_class_II C-term  98.3 1.3E-06 2.9E-11   55.2   5.5   40    1-40      8-47  (161)
 18 cd08343 ED_TypeI_classII_C C-t  98.3 1.3E-06 2.8E-11   52.9   5.2   41    1-42      4-44  (131)
 19 TIGR03081 metmalonyl_epim meth  98.3   8E-07 1.7E-11   52.5   3.7   41    1-41      6-46  (128)
 20 cd07263 Glo_EDI_BRP_like_16 Th  98.2   4E-06 8.7E-11   48.3   5.2   27    1-27      3-29  (119)
 21 cd07237 BphC1-RGP6_C_like C-te  98.2 3.8E-06 8.2E-11   52.8   5.3   42    1-42     14-58  (154)
 22 cd08357 Glo_EDI_BRP_like_18 Th  98.2 1.4E-06 3.1E-11   51.2   2.9   25    1-25      4-28  (125)
 23 cd07258 PpCmtC_C C-terminal do  98.2 4.1E-06 8.9E-11   52.3   5.0   35    2-41      5-39  (141)
 24 cd07249 MMCE Methylmalonyl-CoA  98.2 2.1E-06 4.6E-11   50.4   3.4   40    1-40      5-45  (128)
 25 cd07252 BphC1-RGP6_N_like N-te  98.1 1.3E-06 2.8E-11   52.1   2.1   25    1-25      7-31  (120)
 26 cd08361 PpCmtC_N N-terminal do  98.1 2.2E-06 4.8E-11   51.7   3.0   25    1-25     11-35  (124)
 27 cd08342 HPPD_N_like N-terminal  98.1 6.4E-06 1.4E-10   50.3   5.0   27    1-27      5-31  (136)
 28 cd07265 2_3_CTD_N N-terminal d  98.1 2.3E-06 4.9E-11   50.8   2.9   26    1-26      9-34  (122)
 29 cd07247 SgaA_N_like N-terminal  98.1 5.1E-06 1.1E-10   48.4   3.9   26    1-26      5-30  (114)
 30 cd09014 BphC-JF8_C_like C-term  98.1 1.1E-05 2.4E-10   51.3   5.7   40    1-40     11-50  (166)
 31 COG0346 GloA Lactoylglutathion  98.1 2.9E-06 6.3E-11   48.4   2.7   28    1-28      7-34  (138)
 32 cd09013 BphC-JF8_N_like N-term  98.1 3.9E-06 8.5E-11   49.8   3.0   25    1-25     11-35  (121)
 33 PRK11478 putative lyase; Provi  98.1 4.8E-06   1E-10   49.5   3.3   25    1-25     11-35  (129)
 34 cd08346 PcpA_N_like N-terminal  98.0 1.1E-05 2.3E-10   47.1   4.6   27    1-27      6-32  (126)
 35 cd08345 Fosfomycin_RP Fosfomyc  98.0 4.7E-06   1E-10   48.4   3.0   26    1-26      3-28  (113)
 36 cd08350 BLMT_like BLMT, a bleo  98.0 8.7E-06 1.9E-10   48.3   4.0   25    1-26      7-31  (120)
 37 PF13669 Glyoxalase_4:  Glyoxal  98.0 9.3E-06   2E-10   48.1   3.9   42    1-42      4-45  (109)
 38 cd08349 BLMA_like Bleomycin bi  98.0 7.3E-06 1.6E-10   47.2   3.3   25    2-26      4-28  (112)
 39 TIGR03211 catechol_2_3 catecho  98.0   2E-05 4.4E-10   53.7   5.9   41    1-41    150-191 (303)
 40 PRK06724 hypothetical protein;  98.0 1.7E-05 3.7E-10   48.9   5.0   40    1-40     12-54  (128)
 41 PLN02300 lactoylglutathione ly  98.0 1.6E-05 3.4E-10   54.4   5.3   41    1-41    159-199 (286)
 42 PRK04101 fosfomycin resistance  98.0 1.2E-05 2.7E-10   49.2   4.3   25    1-25      9-33  (139)
 43 PF12681 Glyoxalase_2:  Glyoxal  98.0 9.6E-06 2.1E-10   46.6   3.5   24    2-25      1-24  (108)
 44 cd08354 Glo_EDI_BRP_like_13 Th  98.0 1.7E-05 3.7E-10   46.3   4.6   25    1-25      5-29  (122)
 45 cd08351 ChaP_like ChaP, an enz  98.0   6E-06 1.3E-10   49.3   2.7   25    1-25      9-33  (123)
 46 cd08353 Glo_EDI_BRP_like_7 Thi  98.0 1.6E-05 3.4E-10   48.2   4.5   26    1-27      8-33  (142)
 47 cd07264 Glo_EDI_BRP_like_15 Th  98.0 7.5E-06 1.6E-10   48.2   3.0   25    1-25      5-29  (125)
 48 cd08360 MhqB_like_C C-terminal  98.0 8.3E-06 1.8E-10   49.6   3.2   26    1-26      8-33  (134)
 49 cd09011 Glo_EDI_BRP_like_23 Th  98.0 7.2E-06 1.6E-10   48.6   2.8   25    1-25      7-31  (120)
 50 cd07239 BphC5-RK37_C_like C-te  98.0 1.7E-05 3.8E-10   49.4   4.6   25    1-25      9-33  (144)
 51 cd08352 Glo_EDI_BRP_like_1 Thi  97.9   3E-05 6.4E-10   45.0   5.1   26    1-26      8-33  (125)
 52 KOG2943 Predicted glyoxalase [  97.9 2.4E-06 5.2E-11   59.7   0.2   39    1-43    154-192 (299)
 53 cd07238 Glo_EDI_BRP_like_5 Thi  97.9 1.1E-05 2.4E-10   47.0   3.0   24    1-24      5-28  (112)
 54 cd07255 Glo_EDI_BRP_like_12 Th  97.9 1.7E-05 3.7E-10   46.7   3.8   25    1-25      7-31  (125)
 55 cd08364 FosX FosX, a fosfomyci  97.9 1.3E-05 2.8E-10   48.8   3.3   24    2-25     10-33  (131)
 56 cd08359 Glo_EDI_BRP_like_22 Th  97.9 1.2E-05 2.7E-10   47.1   3.1   25    1-25      6-30  (119)
 57 cd07244 FosA FosA, a Fosfomyci  97.9 1.5E-05 3.2E-10   47.5   3.4   26    1-26      6-31  (121)
 58 cd07251 Glo_EDI_BRP_like_10 Th  97.9   9E-06   2E-10   47.4   2.3   25    1-25      3-27  (121)
 59 TIGR03213 23dbph12diox 2,3-dih  97.9 2.8E-05   6E-10   52.8   4.9   42    1-42    147-191 (286)
 60 TIGR02295 HpaD 3,4-dihydroxyph  97.9 4.4E-05 9.5E-10   51.6   5.8   39    2-40    142-180 (294)
 61 cd08348 BphC2-C3-RGP6_C_like T  97.8 1.9E-05   4E-10   47.4   3.1   26    1-26      6-31  (134)
 62 cd07261 Glo_EDI_BRP_like_11 Th  97.8   1E-05 2.2E-10   47.2   1.8   25    1-25      3-27  (114)
 63 cd08347 PcpA_C_like C-terminal  97.8   2E-05 4.3E-10   50.0   3.2   26    1-26      6-31  (157)
 64 cd07240 ED_TypeI_classII_N N-t  97.8 1.7E-05 3.8E-10   46.0   2.7   26    1-26      7-32  (117)
 65 cd06587 Glo_EDI_BRP_like This   97.8 7.7E-05 1.7E-09   41.4   5.2   27    1-27      3-29  (112)
 66 cd08362 BphC5-RrK37_N_like N-t  97.8 2.3E-05   5E-10   45.9   3.1   24    2-25      9-32  (120)
 67 cd07267 THT_Oxygenase_N N-term  97.8 2.2E-05 4.7E-10   46.3   2.9   24    1-25      8-31  (113)
 68 cd07245 Glo_EDI_BRP_like_9 Thi  97.8 2.5E-05 5.5E-10   44.2   3.0   26    1-26      5-30  (114)
 69 cd07254 Glo_EDI_BRP_like_20 Th  97.8 2.1E-05 4.6E-10   46.3   2.6   25    1-25      6-30  (120)
 70 cd07253 Glo_EDI_BRP_like_2 Thi  97.8 2.4E-05 5.1E-10   45.5   2.6   26    1-26      8-33  (125)
 71 cd08363 FosB FosB, a fosfomyci  97.7 2.6E-05 5.6E-10   47.5   2.6   25    1-25      5-29  (131)
 72 cd07266 HPCD_N_class_II N-term  97.7   3E-05 6.5E-10   45.7   2.6   24    2-25     10-33  (121)
 73 cd09012 Glo_EDI_BRP_like_24 Th  97.7 3.4E-05 7.4E-10   45.9   2.7   25    2-27      6-30  (124)
 74 cd08356 Glo_EDI_BRP_like_17 Th  97.7 3.6E-05 7.9E-10   45.7   2.5   24    1-25      6-29  (113)
 75 cd07242 Glo_EDI_BRP_like_6 Thi  97.6 6.9E-05 1.5E-09   44.4   3.1   26    1-26      6-34  (128)
 76 cd07235 MRD Mitomycin C resist  97.6 5.6E-05 1.2E-09   44.5   2.3   23    1-24      5-27  (122)
 77 TIGR03213 23dbph12diox 2,3-dih  97.6 4.2E-05 9.1E-10   51.9   2.0   24    2-25      9-32  (286)
 78 cd07262 Glo_EDI_BRP_like_19 Th  97.5 7.7E-05 1.7E-09   44.0   2.7   26    1-26      5-33  (123)
 79 TIGR03211 catechol_2_3 catecho  97.5 8.3E-05 1.8E-09   50.7   3.0   26    1-26      9-34  (303)
 80 TIGR02295 HpaD 3,4-dihydroxyph  97.5 0.00011 2.3E-09   49.8   3.4   24    2-25     10-33  (294)
 81 COG2514 Predicted ring-cleavag  97.5 0.00012 2.7E-09   51.2   3.6   38    2-45    174-211 (265)
 82 cd08344 MhqB_like_N N-terminal  97.5  0.0001 2.3E-09   43.2   2.8   24    1-25      7-30  (112)
 83 cd07250 HPPD_C_like C-terminal  97.4 0.00028 6.2E-09   46.2   4.5   39    2-40      9-51  (191)
 84 PF14506 CppA_N:  CppA N-termin  97.4  0.0002 4.3E-09   45.3   3.5   34    1-40      5-38  (125)
 85 COG2514 Predicted ring-cleavag  97.1  0.0018 3.8E-08   45.4   6.1   26    2-27     16-41  (265)
 86 cd06588 PhnB_like Escherichia   96.9  0.0042 9.2E-08   37.5   5.6   26    2-27      5-31  (128)
 87 COG3324 Predicted enzyme relat  96.9  0.0022 4.8E-08   40.6   4.4   26    2-27     15-40  (127)
 88 COG3565 Predicted dioxygenase   96.9  0.0004 8.7E-09   44.0   1.0   24    2-25     10-33  (138)
 89 TIGR01263 4HPPD 4-hydroxypheny  96.3  0.0032 6.8E-08   44.5   2.6   26    2-27    164-191 (353)
 90 COG2764 PhnB Uncharacterized p  96.1   0.022 4.7E-07   36.3   5.5   29    2-30      6-35  (136)
 91 COG3607 Predicted lactoylgluta  95.6  0.0055 1.2E-07   39.1   1.1   24    2-26      9-32  (133)
 92 TIGR01263 4HPPD 4-hydroxypheny  95.5   0.037 8.1E-07   39.1   5.1   24    2-25      8-31  (353)
 93 PRK01037 trmD tRNA (guanine-N(  95.4   0.011 2.4E-07   43.0   2.3   21    2-22    253-273 (357)
 94 PF13468 Glyoxalase_3:  Glyoxal  94.8   0.059 1.3E-06   34.3   4.0   39    2-40      6-44  (175)
 95 PLN02875 4-hydroxyphenylpyruva  93.5    0.13 2.8E-06   37.8   4.1   41    2-42    186-231 (398)
 96 PRK10148 hypothetical protein;  91.4     0.4 8.7E-06   30.3   3.9   25    2-26      7-32  (147)
 97 PF14507 CppA_C:  CppA C-termin  87.8    0.17 3.7E-06   30.9   0.1   17    2-19     11-27  (101)
 98 PF06983 3-dmu-9_3-mt:  3-demet  80.9     2.8 6.2E-05   25.4   3.4   17    5-21     11-27  (116)
 99 PF13225 DUF4033:  Domain of un  79.8       5 0.00011   23.9   4.1   28   10-37     49-76  (86)
100 KOG4657 Uncharacterized conser  76.4     6.2 0.00013   27.6   4.3   35    5-42    145-179 (246)
101 PLN02875 4-hydroxyphenylpyruva  66.3      16 0.00034   27.1   4.8   26    2-27      6-31  (398)
102 PF13176 TPR_7:  Tetratricopept  63.4     5.9 0.00013   18.8   1.5   17    4-20     12-28  (36)
103 COG3185 4-hydroxyphenylpyruvat  56.1      11 0.00024   27.8   2.4   28    3-30    176-203 (363)
104 PF13523 Acetyltransf_8:  Acety  53.0      26 0.00056   21.0   3.4   26    6-32    123-148 (152)
105 cd00034 ChSh Chromo Shadow Dom  52.1       7 0.00015   20.9   0.7   17    3-19     36-52  (54)
106 COG0456 RimI Acetyltransferase  50.1      26 0.00057   21.2   3.1   21    6-27    136-156 (177)
107 smart00300 ChSh Chromo Shadow   50.0     7.5 0.00016   21.2   0.6   18    3-20     42-59  (61)
108 PF08445 FR47:  FR47-like prote  47.3      46   0.001   18.7   3.7   20    5-25     63-82  (86)
109 PF15067 FAM124:  FAM124 family  46.0      19 0.00041   25.1   2.2   24    2-25    134-159 (236)
110 PF00515 TPR_1:  Tetratricopept  40.3      24 0.00052   15.8   1.5   15    5-19     15-29  (34)
111 PF11782 DUF3319:  Protein of u  38.7      20 0.00043   21.5   1.2   12    6-17     36-47  (88)
112 PF01393 Chromo_shadow:  Chromo  36.3      26 0.00056   19.0   1.4   16    4-19     40-55  (58)
113 PRK10514 putative acetyltransf  36.0      69  0.0015   18.7   3.4   20    6-26    108-127 (145)
114 PHA03397 vlf-1 very late expre  33.7      25 0.00055   25.8   1.3   16    6-21    124-139 (363)
115 PF04761 Phage_Treg:  Lactococc  33.5      29 0.00063   18.9   1.3   12    8-19     16-27  (57)
116 PF13181 TPR_8:  Tetratricopept  33.1      40 0.00087   14.9   1.6   16    4-19     14-29  (34)
117 PF13420 Acetyltransf_4:  Acety  31.5      63  0.0014   19.1   2.7   22    5-27    120-141 (155)
118 COG0189 RimK Glutathione synth  31.0 1.3E+02  0.0028   21.4   4.5   41    2-42    138-178 (318)
119 smart00671 SEL1 Sel1-like repe  30.5      46   0.001   14.8   1.6   13    5-17     19-31  (36)
120 PF03634 TCP:  TCP family trans  30.4      42 0.00092   20.7   1.8   18    6-23     25-44  (138)
121 PTZ00330 acetyltransferase; Pr  29.7      69  0.0015   18.7   2.6   18    7-25    124-141 (147)
122 PF07719 TPR_2:  Tetratricopept  27.3      53  0.0011   14.3   1.5   16    4-19     14-29  (34)
123 PRK10562 putative acetyltransf  27.3 1.1E+02  0.0024   18.1   3.2   21    5-26    106-126 (145)
124 PHA02503 putative transcriptio  27.2      44 0.00094   18.2   1.3   11    8-18     16-26  (57)
125 smart00733 Mterf Mitochondrial  26.5      35 0.00075   14.4   0.7   16    4-20     15-30  (31)
126 PRK13688 hypothetical protein;  26.2 1.7E+02  0.0037   18.4   4.1   18    8-26    117-134 (156)
127 TIGR03585 PseH pseudaminic aci  25.4      86  0.0019   18.4   2.5   21    5-26    119-139 (156)
128 PF02208 Sorb:  Sorbin homologo  25.2      32  0.0007   18.3   0.5   17    2-18     17-33  (47)
129 PF08238 Sel1:  Sel1 repeat;  I  24.8      39 0.00085   15.4   0.8   13    5-17     22-34  (39)
130 PHA00212 putative transcriptio  24.5      51  0.0011   18.2   1.3   11    8-18     18-28  (63)
131 PRK10140 putative acetyltransf  24.1      95  0.0021   18.3   2.6   20    6-26    123-142 (162)
132 PF05100 Phage_tail_L:  Phage m  24.1 1.2E+02  0.0026   20.7   3.2   26    2-27     51-80  (206)
133 KOG4410 5-formyltetrahydrofola  23.2      91   0.002   22.9   2.6   40    2-48    342-382 (396)
134 KOG2640 Thioredoxin [Function   21.9 1.7E+02  0.0037   21.4   3.8   22    4-25    148-169 (319)
135 PF07901 DUF1672:  Protein of u  20.8 2.5E+02  0.0055   20.1   4.4   35    8-42     40-74  (277)
136 KOG0638 4-hydroxyphenylpyruvat  20.6      82  0.0018   23.4   2.0   23    2-24     23-45  (381)
137 PRK10314 putative acyltransfer  20.6   1E+02  0.0023   19.0   2.3   18    7-25    117-134 (153)

No 1  
>PLN02367 lactoylglutathione lyase
Probab=99.67  E-value=2.4e-16  Score=107.61  Aligned_cols=67  Identities=88%  Similarity=1.427  Sum_probs=58.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCCCCCCCCCccccceeccCCceeeeeC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELT   67 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~~~~~~~~~~~~~~~~~~~~g~leLt   67 (67)
                      ||||+|+++|++||+++|||++..+.++++++|+++||++++..+.+.|.+....|.+.+.++||||
T Consensus        80 mlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LELt  146 (233)
T PLN02367         80 MYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIELT  146 (233)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEEe
Confidence            7999999999999999999999999999988999999999776555666556777988888899996


No 2  
>PLN03042 Lactoylglutathione lyase; Provisional
Probab=99.52  E-value=4.6e-14  Score=93.03  Aligned_cols=67  Identities=87%  Similarity=1.419  Sum_probs=54.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCCCCCCCCCccccceeccCCceeeeeC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELT   67 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~~~~~~~~~~~~~~~~~~~~g~leLt   67 (67)
                      ||+|+|+++|++||+++|||++..+...+.++++++|+++++....|.+....-.|++.+.+.|||+
T Consensus        32 ~i~V~Dle~Si~FY~~vLG~~~~~r~~~~~~~~~~~fl~~~~~~~~~~~~~~~~~~l~~~~~~lEL~   98 (185)
T PLN03042         32 MFRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDSETAPTDPPERTVWTFGRKATIELT   98 (185)
T ss_pred             EEeeCCHHHHHHHHHhhcCCEEEEEEEcCCCceEEEEEecCCcccCCcchhhcccccccCCCEEEEE
Confidence            6999999999999999999999999887777899999998654433343344556777788889984


No 3  
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=99.34  E-value=3.1e-12  Score=80.07  Aligned_cols=41  Identities=34%  Similarity=0.736  Sum_probs=35.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCC-----------CeEEEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPE-----------MKFSLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~-----------~~~~l~fL~~g   41 (67)
                      ||+|+|+++|++||+++|||+++++.++++           +++.++||+++
T Consensus         7 ~irV~DlerSi~FY~~vLG~~~~~~~~~~~~~~~~~~~~~~g~~~~~~l~~~   58 (127)
T cd08358           7 VFKVGNRNKTIKFYREVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMIGYG   58 (127)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEEeeecCccccccccccCCCCcEEEEEEecC
Confidence            699999999999999999999988887665           56677788764


No 4  
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism]
Probab=99.14  E-value=1e-11  Score=81.25  Aligned_cols=67  Identities=51%  Similarity=0.793  Sum_probs=60.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCCCCCCCCCccccceeccCCceeeeeC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTASAPADPVDRTVWTFGKPATIELT   67 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~~~~~~~~~~~~~~~~~~~~g~leLt   67 (67)
                      |+||+|+.+|+.||++++||.+..+..+++..|.++||++...+..|.++..+..|...+++.+|||
T Consensus        27 ~~rvkd~~~Sl~fytr~~gm~l~~~~~fke~~Fsl~fL~~~~~~~vP~~~~~~~v~~~~~~~~~ELt   93 (170)
T KOG2944|consen   27 MLRVKDPTGSLKFYTRVNGMALLVPDDFKEAKFSLYFLGAEVSEDVPKPEHGVSVFVFSRNAKLELT   93 (170)
T ss_pred             eeecccchhhhhhhhhhccceeechhhhhHhhhHHHhhcccccccCccCCCCCceEEecccCceeee
Confidence            7999999999999999999999988888888899999999877666777777779988899999997


No 5  
>PRK10291 glyoxalase I; Provisional
Probab=99.07  E-value=4.6e-10  Score=67.86  Aligned_cols=42  Identities=50%  Similarity=0.893  Sum_probs=36.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      ||+|+|+++|++||+++|||++..+...+..++.++|++.++
T Consensus         1 ~l~V~Dle~s~~FY~~~LG~~~~~~~~~~~~~~~~~~~~~~~   42 (129)
T PRK10291          1 MLRVGDLQRSIDFYTNVLGMKLLRTSENPEYKYSLAFVGYGP   42 (129)
T ss_pred             CEEecCHHHHHHHHHhccCCEEEEeecCCCCcEEEEEEccCC
Confidence            799999999999999999999988776666678889987654


No 6  
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism]
Probab=98.92  E-value=7e-10  Score=77.09  Aligned_cols=44  Identities=39%  Similarity=0.729  Sum_probs=40.5

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCC-----------CeEEEEEeccCCCCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPE-----------MKFSLYFLGYEDTAS   45 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~-----------~~~~l~fL~~g~~~~   45 (67)
                      ++|.|++++++||+++|||++.|..++++           ++++.+|+|+|++++
T Consensus        23 fkVgdr~kti~Fyt~vlgMkvLRheef~egc~aacngpyd~kwSktmvGyGpEds   77 (299)
T KOG2943|consen   23 FKVGDRAKTIDFYTEVLGMKVLRHEEFEEGCEAACNGPYDGKWSKTMVGYGPEDS   77 (299)
T ss_pred             EeecchHHHHHHHHHhhcceeeehhhhhhhhhhhcCCCcccchhhhheecCCCcc
Confidence            68999999999999999999999988888           899999999998754


No 7  
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=98.68  E-value=4.6e-08  Score=57.37  Aligned_cols=41  Identities=24%  Similarity=0.446  Sum_probs=30.7

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g   41 (67)
                      +|.|+|+++|++||+++|||++..+...+..++..+|+..+
T Consensus         6 ~l~v~dl~~s~~FY~~~lg~~~~~~~~~~~~~~~~~~~~~~   46 (125)
T cd07241           6 AIWTKDLERMKAFYVTYFGATSNEKYHNPRKGFESYFLSFD   46 (125)
T ss_pred             EEEecCHHHHHHHHHHHhCCEeeceEeCCCCCceEEEEecC
Confidence            48899999999999999999987655433334555666553


No 8  
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic gly
Probab=98.56  E-value=2e-07  Score=54.62  Aligned_cols=42  Identities=67%  Similarity=1.121  Sum_probs=34.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +|.|+|+++|++||+++||+++..+...+++++..+|+..++
T Consensus         5 ~i~v~d~~~a~~fY~~~lG~~~~~~~~~~~~~~~~~~l~~~~   46 (121)
T cd07233           5 MLRVKDLEKSLDFYTDVLGMKLLRRKDFPEGKFTLVFLGYPD   46 (121)
T ss_pred             EEEecCcHHHHHHHHhccCCeEEEEEecCCCceEEEEecCCC
Confidence            478999999999999999999987765555457778887654


No 9  
>TIGR00068 glyox_I lactoylglutathione lyase. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice.
Probab=98.53  E-value=2.7e-07  Score=57.29  Aligned_cols=42  Identities=67%  Similarity=1.126  Sum_probs=33.7

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +|+|.|+++|++||+++|||++..+...+.+++..+|++.++
T Consensus        22 ~l~v~Dl~~a~~FY~~vLG~~~~~~~~~~~~~~~~~~~~~~~   63 (150)
T TIGR00068        22 MLRVGDLDKSLDFYTEVLGMKLLRKRDFPEMKFSLAFLGYGD   63 (150)
T ss_pred             EEEecCHHHHHHHHHHhcCCEEEEEeccCCCceEEEEecCCC
Confidence            378999999999999999999987665555556677887653


No 10 
>PLN02300 lactoylglutathione lyase
Probab=98.53  E-value=2.4e-07  Score=63.37  Aligned_cols=42  Identities=40%  Similarity=0.836  Sum_probs=34.7

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +|+|+|+++|++||+++|||++..+...+...+..+|++.++
T Consensus        29 ~l~V~Dle~s~~FY~~vLG~~~~~~~~~~~~~~~~~~l~~g~   70 (286)
T PLN02300         29 VYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGP   70 (286)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEEEeeecCCCcEEEEEEccCC
Confidence            489999999999999999999987766556667778887653


No 11 
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the C-terminal, catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the C-terminal domain.
Probab=98.52  E-value=3.2e-07  Score=57.15  Aligned_cols=41  Identities=22%  Similarity=0.261  Sum_probs=29.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeE-EEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKF-SLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~-~l~fL~~g   41 (67)
                      +|+|+|+++|++||+++|||++..+...+++.. ..+|+..+
T Consensus        11 ~l~v~Dle~s~~FY~~vLGf~~~~~~~~~~~~~~~~~~l~~~   52 (143)
T cd07243          11 LLTGEDIAETTRFFTDVLDFYLAERVVDPDGGTRVGSFLSCS   52 (143)
T ss_pred             EEecCCHHHHHHHHHHhcCCEEEEEEecCCCCeEEEEEEecC
Confidence            489999999999999999999877654333322 34566443


No 12 
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway. This subfamily contains the C-terminal, catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.
Probab=98.48  E-value=3.1e-07  Score=57.68  Aligned_cols=42  Identities=19%  Similarity=0.362  Sum_probs=32.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCC-CCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFP-EMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~-~~~~~l~fL~~g~   42 (67)
                      +|.|+|+++|++||+++|||++..+...+ .++..++|+..++
T Consensus         6 ~l~V~Dle~a~~FY~~~LG~~~~~~~~~~~~~~~~~~~l~~~~   48 (153)
T cd07257           6 VLEVPDFAASFDWYTETFGLKPSDVIYLPGPGNPVAAFLRLDR   48 (153)
T ss_pred             EEecCCHHHHHHHHHHhcCCeEEeeEecCCCCCcEEEEEecCC
Confidence            48899999999999999999997665443 2335677887643


No 13 
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=98.42  E-value=9.6e-07  Score=52.31  Aligned_cols=30  Identities=13%  Similarity=0.261  Sum_probs=25.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEM   31 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~   31 (67)
                      |.|+|+++|++||+++||+++..+...+.+
T Consensus         5 l~v~d~~~a~~FY~~~lG~~~~~~~~~~~~   34 (122)
T cd08355           5 LRYRDAAAAIDWLTDAFGFEERLVVPDDDG   34 (122)
T ss_pred             EEECCHHHHHHHHHHhcCCEEEEEEeCCCC
Confidence            789999999999999999999876543333


No 14 
>PF00903 Glyoxalase:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein.;  InterPro: IPR004360 Glyoxalase I (4.4.1.5 from EC) (lactoylglutathione lyase) catalyzes the first step of the glyoxal pathway. S-lactoylglutathione is then converted by glyoxalase II to lactic acid []. Glyoxalase I is an ubiquitous enzyme which binds one mole of zinc per subunit. The bacterial and yeast enzymes are monomeric while the mammalian one is homodimeric. The sequence of glyoxalase I is well conserved. The domain represented by this entry is found in glyoxalase I and in other related proteins, including fosfomycin resistance proteins FosB [], FosA [], FosX [] and dioxygenases (eg. 4-hydroxyphenylpyruvate dioxygenase).; PDB: 1CJX_A 1NPB_E 3OJT_C 3OJN_A 2IG9_B 3OJJ_B 3OJK_D 1Q0C_D 1F1X_C 3BZA_B ....
Probab=98.41  E-value=1.1e-06  Score=51.18  Aligned_cols=42  Identities=31%  Similarity=0.535  Sum_probs=31.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe--CCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD--FPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~--~~~~~~~l~fL~~g~   42 (67)
                      +|+|+|+++|++||+++|||++.....  ........+++..+.
T Consensus         6 ~i~v~d~~~~~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~   49 (128)
T PF00903_consen    6 AIRVKDLEKAIDFYTDVLGFRLVEESDNDGEGGDLRIAFLRIGE   49 (128)
T ss_dssp             EEEESCHHHHHHHHHHTTTSEEEEEEEEESTTEEEEEEEEESTS
T ss_pred             EEEcCCHHHHHHHHHHHhCCcEEeeeccccccccccceeecccc
Confidence            478999999999999999999988765  222334555555544


No 15 
>TIGR03645 glyox_marine lactoylglutathione lyase family protein. Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.
Probab=98.40  E-value=5.5e-07  Score=57.20  Aligned_cols=25  Identities=28%  Similarity=0.514  Sum_probs=22.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|++||+++|||+++.+
T Consensus         9 ~i~V~Dle~s~~FY~~~LG~~~~~~   33 (162)
T TIGR03645         9 GISVPDLDAAVKFYTEVLGWYLIMP   33 (162)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEEec
Confidence            4899999999999999999998653


No 16 
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=98.37  E-value=1.5e-06  Score=50.80  Aligned_cols=30  Identities=23%  Similarity=0.531  Sum_probs=25.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEM   31 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~   31 (67)
                      |.|+|+++|++||+++||+++..+...+.+
T Consensus         7 l~v~d~~~a~~FY~~~lG~~~~~~~~~~~~   36 (122)
T cd07246           7 LIVRDAAAAIDFYKKAFGAEELERMPDDDG   36 (122)
T ss_pred             EEECCHHHHHHHHHHhhCCEEEEEEeCCCC
Confidence            789999999999999999999877653333


No 17 
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the C-terminal, catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of 
Probab=98.35  E-value=1.3e-06  Score=55.18  Aligned_cols=40  Identities=18%  Similarity=0.228  Sum_probs=29.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEecc
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      +|.|+|+++|++||+++|||++......+.+.....|+..
T Consensus         8 ~l~V~Dl~~s~~FY~~vLGl~~~~~~~~~~~~~~~~~l~~   47 (161)
T cd07256           8 NLRVPDVDAGLAYYRDELGFRVSEYTEDDDGTTWAAWLHR   47 (161)
T ss_pred             EEecCCHHHHHHHHHhccCCEEEEEeccCCCcEEEEEEec
Confidence            3889999999999999999998755433233334456643


No 18 
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain. This family contains the C-terminal, catalytic domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this family are 
Probab=98.35  E-value=1.3e-06  Score=52.87  Aligned_cols=41  Identities=27%  Similarity=0.445  Sum_probs=31.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +|.|+|+++|++||+++|||++..+...+ +....+|+..++
T Consensus         4 ~l~V~dl~~a~~Fy~~~lG~~~~~~~~~~-~~~~~~~~~~~~   44 (131)
T cd08343           4 VLRTPDVAATAAFYTEVLGFRVSDRVGDP-GVDAAAFLRCDE   44 (131)
T ss_pred             EEEcCCHHHHHHHHHhcCCCEEEEEEccC-CceeEEEEEcCC
Confidence            47899999999999999999997765433 334566776553


No 19 
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase. Members of this protein family are the enzyme methylmalonyl-CoA epimerase (EC 5.1.99.1), also called methylmalonyl-CoA racemase. This enzyme converts (2R)-methylmalonyl-CoA to (2S)-methylmalonyl-CoA, which is then a substrate for methylmalonyl-CoA mutase (TIGR00642). It is known in bacteria, archaea, and as a mitochondrial protein in animals. It is closely related to lactoylglutathione lyase (TIGR00068), which is also called glyoxylase I, and is also a homodimer.
Probab=98.31  E-value=8e-07  Score=52.45  Aligned_cols=41  Identities=20%  Similarity=0.340  Sum_probs=30.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g   41 (67)
                      +|.|+|+++|++||+++||+++......+..++.++++..+
T Consensus         6 ~l~v~D~~~s~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~   46 (128)
T TIGR03081         6 GIAVPDLEEAAKLYEDVLGAHVSHIEEVPEQGVKVVFIALG   46 (128)
T ss_pred             EEEeCCHHHHHHHHHHHhCCCCccceeCCCCCcEEEEEecC
Confidence            37899999999999999999987654333334456666544


No 20 
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=98.22  E-value=4e-06  Score=48.27  Aligned_cols=27  Identities=22%  Similarity=0.489  Sum_probs=24.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      +|+|.|+++|++||+++|||++..+..
T Consensus         3 ~l~v~d~~~~~~fY~~~lG~~~~~~~~   29 (119)
T cd07263           3 SLYVDDQDKALAFYTEKLGFEVREDVP   29 (119)
T ss_pred             eEEeCCHHHHHHHHHhccCeEEEEeec
Confidence            489999999999999999999987654


No 21 
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the C-terminal, catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its C-terminal repeat is represented in thi
Probab=98.21  E-value=3.8e-06  Score=52.78  Aligned_cols=42  Identities=29%  Similarity=0.513  Sum_probs=31.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCC---CCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFP---EMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~---~~~~~l~fL~~g~   42 (67)
                      +|.|+|+++|++||+++|||++..+...+   +++..++|+..++
T Consensus        14 ~l~v~Dl~~a~~FY~~~LGl~~~~~~~~~~~~~~~~~~~~l~~~~   58 (154)
T cd07237          14 VLATPDPDEAHAFYRDVLGFRLSDEIDIPLPPGPTARVTFLHCNG   58 (154)
T ss_pred             EEEeCCHHHHHHHHHHccCCEEEEEEcccCCCCCcceEEEEEeCC
Confidence            37899999999999999999987654332   1245677776643


No 22 
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=98.19  E-value=1.4e-06  Score=51.18  Aligned_cols=25  Identities=24%  Similarity=0.413  Sum_probs=22.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|++||+++|||++...
T Consensus         4 ~l~v~Dl~~s~~FY~~~lG~~~~~~   28 (125)
T cd08357           4 AIPVRDLEAARAFYGDVLGCKEGRS   28 (125)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEeec
Confidence            4899999999999999999998654


No 23 
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the C-terminal, catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as for other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=98.18  E-value=4.1e-06  Score=52.34  Aligned_cols=35  Identities=11%  Similarity=0.229  Sum_probs=28.1

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYE   41 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g   41 (67)
                      |+|+|+++|++||+++|||++..+..  .   .++||...
T Consensus         5 l~V~Dle~s~~Fy~~vLG~~~~~~~~--~---~~~~l~~~   39 (141)
T cd07258           5 IGSENFEASRDSLVEDFGFRVSDLIE--D---RIVFMRCH   39 (141)
T ss_pred             EecCCHHHHHHHHHhcCCCEeeeeeC--C---EEEEEEcC
Confidence            79999999999999999999877642  1   35677643


No 24 
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, also called methylmalonyl-CoA racemase (EC 5.1.99.1) interconverts (2R)-methylmalonyl-CoA and (2S)-methylmalonyl-CoA. MMCE has been found in bacteria, archaea, and in animals. In eukaryotes, MMCE is an essential enzyme in a pathway that converts propionyl-CoA to succinyl-CoA, and is important in the breakdown of odd-chain length fatty acids, branched-chain amino acids, and other metabolites. In bacteria, MMCE participates in the reverse pathway for propionate fermentation, glyoxylate regeneration, and the biosynthesis of polyketide antibiotics. MMCE is closely related to glyoxalase I and type I extradiol dioxygenases.
Probab=98.18  E-value=2.1e-06  Score=50.39  Aligned_cols=40  Identities=28%  Similarity=0.522  Sum_probs=30.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCC-CCeEEEEEecc
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFP-EMKFSLYFLGY   40 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~-~~~~~l~fL~~   40 (67)
                      +|.|+|+++|++||+++|||++......+ .+.+..+|+..
T Consensus         5 ~l~v~d~~~~~~fy~~~lG~~~~~~~~~~~~~~~~~~~~~~   45 (128)
T cd07249           5 GIAVPDLEAAIKFYRDVLGVGPWEEEEVPPEQGVRVAFLGL   45 (128)
T ss_pred             EEEeCCHHHHHHHHHHhhCCCCccccccCcccccEEEEEEc
Confidence            47899999999999999999997665432 23355666654


No 25 
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1.13.11.39) 1 from Rhodococcus globerulus P6 (BphC1-RGP6) and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of BphC1-RGP6 and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of 2,3-dihydroxybiphenyl 1,2-dioxygenases. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC1-RGP6 has an internal duplication, it is a two-domain dioxygenase which forms octamers, and has Fe(II) at the catalytic site. Its N-
Probab=98.14  E-value=1.3e-06  Score=52.11  Aligned_cols=25  Identities=24%  Similarity=0.243  Sum_probs=22.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|+|+|+++|++||+++|||++..+
T Consensus         7 ~l~v~Dl~~s~~FY~~~LG~~~~~~   31 (120)
T cd07252           7 GVESSDLDAWRRFATDVLGLQVGDR   31 (120)
T ss_pred             EEEeCCHHHHHHHHHhccCceeccC
Confidence            4899999999999999999998654


No 26 
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC). This subfamily contains the N-terminal, non-catalytic, domain of PpCmtC. 2,3-dihydroxy-p-cumate-3,4-dioxygenase (CmtC of Pseudomonas putida F1) is a dioxygenase involved in the eight-step catabolism pathway of p-cymene. CmtC acts upon the reaction intermediate 2,3-dihydroxy-p-cumate, yielding 2-hydroxy-3-carboxy-6-oxo-7-methylocta-2,4-dienoate. The CmtC belongs to the type I family of extradiol dioxygenases. Fe2+ was suggested as a cofactor, same as other enzymes in the family. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=98.14  E-value=2.2e-06  Score=51.66  Aligned_cols=25  Identities=20%  Similarity=0.385  Sum_probs=22.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|++||+++|||++..+
T Consensus        11 ~l~v~d~~~s~~FY~~vLG~~~~~~   35 (124)
T cd08361          11 RLGTRDLAGATRFATDILGLQVAER   35 (124)
T ss_pred             EEeeCCHHHHHHHHHhccCceeccC
Confidence            3789999999999999999998654


No 27 
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS). HppD and HmaS are non-heme iron-dependent dioxygenases, which modify a common substrate, 4-hydroxyphenylpyruvate (HPP), but yield different products. HPPD catalyzes the second reaction in tyrosine catabolism, the conversion of HPP to homogentisate (2,5-dihydroxyphenylacetic acid, HG). HmaS converts HPP to 4-hydroxymandelate, a committed step in the formation of hydroxyphenylglycerine, a structural component of nonproteinogenic macrocyclic peptide antibiotics, such as vancomycin. If the emphasis is on catalytic chemistry, HPPD and HmaS are classified as members of a large family of alpha-keto acid dependent mononuclear non-heme iron oxygenases most of which require Fe(II), molecular oxygen, and an alpha-keto acid (typically alpha-ketoglutarate) to either oxygenate or oxidize a third substrate. Both enzymes are exceptions in that they require two, instead of three, su
Probab=98.13  E-value=6.4e-06  Score=50.33  Aligned_cols=27  Identities=19%  Similarity=0.292  Sum_probs=23.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      .|.|.|+++|++||+++||+++..+..
T Consensus         5 ~i~V~D~e~s~~FY~~vLGf~~~~~~~   31 (136)
T cd08342           5 EFYVGNAKQLASWFSTKLGFEPVAYHG   31 (136)
T ss_pred             EEEeCCHHHHHHHHHHhcCCeEEEecC
Confidence            378999999999999999999987654


No 28 
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase. This subfamily contains the N-terminal, non-catalytic, domain of catechol 2,3-dioxygenase. Catechol 2,3-dioxygenase  (2,3-CTD, catechol:oxygen 2,3-oxidoreductase) catalyzes an extradiol cleavage of catechol to form 2-hydroxymuconate semialdehyde with the insertion of two atoms of oxygen. The enzyme is a homotetramer and contains catalytically essential Fe(II) . The reaction proceeds by an ordered bi-unit mechanism. First, catechol binds to the enzyme, this is then followed by the binding of dioxygen to form a tertiary complex, and then the aromatic ring is cleaved to produce 2-hydroxymuconate semialdehyde. Catechol 2,3-dioxygenase belongs to the type I extradiol dioxygenase family. The subunit comprises the N- and C-terminal domains of similar structure fold, resulting from an ancient gene duplication. The active site is located in a funnel-shaped space of the C-terminal domain. This subfamily represents the N-terminal do
Probab=98.13  E-value=2.3e-06  Score=50.79  Aligned_cols=26  Identities=27%  Similarity=0.470  Sum_probs=23.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .|+|+|+++|++||+++|||++..+.
T Consensus         9 ~l~v~Dl~~s~~FY~~~lG~~~~~~~   34 (122)
T cd07265           9 QLRVLDLEEAIKHYREVLGLDEVGRD   34 (122)
T ss_pred             EEEeCCHHHHHHHHHhccCCEeeeec
Confidence            37899999999999999999987653


No 29 
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a strep
Probab=98.09  E-value=5.1e-06  Score=48.41  Aligned_cols=26  Identities=23%  Similarity=0.379  Sum_probs=23.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|+|+++|++||+++|||++....
T Consensus         5 ~l~v~d~~~s~~FY~~~lG~~~~~~~   30 (114)
T cd07247           5 ELPTTDPERAKAFYGAVFGWTFEDMG   30 (114)
T ss_pred             EeeCCCHHHHHHHHHhccCceeeecc
Confidence            47899999999999999999997543


No 30 
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C. Th
Probab=98.09  E-value=1.1e-05  Score=51.34  Aligned_cols=40  Identities=20%  Similarity=0.267  Sum_probs=28.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEecc
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      .|.|.|+++|++||+++|||++..+...+.+.....|+..
T Consensus        11 ~l~V~Dle~a~~FY~~vLG~~~~~~~~~~~~~~~~~~~~~   50 (166)
T cd09014          11 NLLASDVDANRDFMEEVLGFRLREQIRLDNGKEAGAWMSV   50 (166)
T ss_pred             EEEcCCHHHHHHHHHHccCCEEEEEEecCCCceEEEEEeC
Confidence            3789999999999999999998766543333333345544


No 31 
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism]
Probab=98.09  E-value=2.9e-06  Score=48.42  Aligned_cols=28  Identities=36%  Similarity=0.604  Sum_probs=25.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDF   28 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~   28 (67)
                      +|.|+|+++|++||+++|||+++.+...
T Consensus         7 ~l~v~dl~~s~~FY~~~LG~~~~~~~~~   34 (138)
T COG0346           7 TLAVPDLEASIDFYTDVLGLRLVKDTVN   34 (138)
T ss_pred             EEeeCCHhHhHHHHHhhcCCeeeeeccc
Confidence            4789999999999999999999887653


No 32 
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp. JF8 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, a key step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). BphC belongs to the type I extradiol dioxygenase family, which requires a metal ion in the active site in its catalytic mechanism. Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. This subfamily of BphC is represented by the enzyme purified from the thermophilic biphenyl and naphthalene degrader, Bacillus sp. JF8. The members in this family of BphC enzymes may use either Mn(II) or Fe(II) as cofactors. The enzyme purified from Bacillus sp. JF8 is Mn(II)-dependent, however, the enzyme from Rhodococcus jostii RHAI has Fe(II) bound to it. BphC_JF8 is thermostable and its optimum activity is at 85 degrees C
Probab=98.06  E-value=3.9e-06  Score=49.80  Aligned_cols=25  Identities=32%  Similarity=0.465  Sum_probs=22.8

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||+++|||++..+
T Consensus        11 ~l~v~dl~~a~~FY~~~lG~~~~~~   35 (121)
T cd09013          11 ELLTPKPEESLWFFTDVLGLEETGR   35 (121)
T ss_pred             EEEeCCHHHHHHHHHhCcCCEEEee
Confidence            3789999999999999999999765


No 33 
>PRK11478 putative lyase; Provisional
Probab=98.06  E-value=4.8e-06  Score=49.50  Aligned_cols=25  Identities=32%  Similarity=0.479  Sum_probs=22.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|.|+++|++||+++|||++..+
T Consensus        11 ~l~v~D~~~a~~FY~~~LG~~~~~~   35 (129)
T PRK11478         11 AIIATDYAVSKAFYCDILGFTLQSE   35 (129)
T ss_pred             EEEcCCHHHHHHHHHHHhCCEeccc
Confidence            3789999999999999999998643


No 34 
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The N-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=98.04  E-value=1.1e-05  Score=47.10  Aligned_cols=27  Identities=33%  Similarity=0.664  Sum_probs=24.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      +|.|.|+++|++||+++|||++..+..
T Consensus         6 ~l~v~d~~~a~~FY~~~lG~~~~~~~~   32 (126)
T cd08346           6 TLITRDAQETVDFYTDVLGLRLVKKTV   32 (126)
T ss_pred             EEEcCChhHhHHHHHHccCCEEeeeEe
Confidence            478999999999999999999977654


No 35 
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin. This family contains three types of fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. The three types of fosfomycin resistance proteins, employ different mechanisms to render fosfomycin [(1R,2S)-epoxypropylphosphonic acid] inactive. FosB catalyzes the addition of L-cysteine to the epoxide ring of fosfomycin. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. FosA catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. Catalytic activities of both FosX and FosA are Mn(II)-dependent, but FosB is activated by Mg(II). Fosfomycin resistant proteins are evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=98.04  E-value=4.7e-06  Score=48.38  Aligned_cols=26  Identities=31%  Similarity=0.531  Sum_probs=23.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|+|+|+++|++||+++|||++..+.
T Consensus         3 ~l~v~d~~~s~~Fy~~~lg~~~~~~~   28 (113)
T cd08345           3 TLIVKDLNKSIAFYRDILGAELIYSS   28 (113)
T ss_pred             eEEECCHHHHHHHHHHhcCCeeeecc
Confidence            58999999999999999999987654


No 36 
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins. BLMT is a bleomycin (Bm) resistance protein, encoded by the ble gene on the transposon Tn5. This protein confers a survival advantage to Escherichia coli host cells. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMT has strong binding affinity to Bm and it protects against this lethal compound through drug sequestering. BLMT has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMT is a dimer with two Bm-binding pockets formed at the dimer interface.
Probab=98.02  E-value=8.7e-06  Score=48.32  Aligned_cols=25  Identities=32%  Similarity=0.462  Sum_probs=22.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|+|+++|++||++ |||++..+.
T Consensus         7 ~l~v~Dl~~s~~FY~~-lG~~~~~~~   31 (120)
T cd08350           7 NLPSRDLDATEAFYAR-LGFSVGYRQ   31 (120)
T ss_pred             eeEcCCHHHHHHHHHH-cCCEEEecC
Confidence            4889999999999999 999997653


No 37 
>PF13669 Glyoxalase_4:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A.
Probab=98.01  E-value=9.3e-06  Score=48.11  Aligned_cols=42  Identities=24%  Similarity=0.290  Sum_probs=34.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +|.|+|++++++||+++||++.......+..++++.|+..++
T Consensus         4 ~i~V~Dl~~a~~~~~~~lG~~~~~~~~~~~~~v~~~~~~~~~   45 (109)
T PF13669_consen    4 GIVVPDLDAAAAFYCDVLGFEPWERYRDEPQGVRVAFLYLGD   45 (109)
T ss_dssp             EEEES-HHHHHHHHHHCTTHEEEEEEEEGCTTEEEEEEEETT
T ss_pred             EEEcCCHHHHHHHHHHhhCCcEEEEEecCCCCEEEEEEEeCC
Confidence            378999999999999999999877766666667777877765


No 38 
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the large
Probab=98.00  E-value=7.3e-06  Score=47.18  Aligned_cols=25  Identities=32%  Similarity=0.460  Sum_probs=22.9

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      |+|+|+++|++||+++|||++..+.
T Consensus         4 i~v~d~~~s~~FY~~~lg~~~~~~~   28 (112)
T cd08349           4 LPVSDIERSLAFYRDVLGFEVDWEH   28 (112)
T ss_pred             EEECCHHHHHHHHHhccCeEEEEEc
Confidence            7899999999999999999997654


No 39 
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase. Members of this family all are enzymes active as catechol 2,3 dioxygenase (1.13.11.2), although some members have highly significant activity on catechol derivatives such as 3-methylcatechol, 3-chlorocatechol, and 4-chlorocatechol (see Mars, et al.). This enzyme is also called metapyrocatechase, as it performs a meta-cleavage (an extradiol ring cleavage), in contrast to the ortho-cleavage (intradiol ring cleavage)performed by catechol 1,2-dioxygenase (EC 1.13.11.1), also called pyrocatechase.
Probab=98.00  E-value=2e-05  Score=53.68  Aligned_cols=41  Identities=20%  Similarity=0.302  Sum_probs=30.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeE-EEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKF-SLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~-~l~fL~~g   41 (67)
                      .|.|+|+++|++||+++|||++..+...+.+.. ...|+..+
T Consensus       150 ~l~V~Dl~~s~~FY~~~LG~~~~~~~~~~~~~~~~~~~~~~~  191 (303)
T TIGR03211       150 LLYGEDVAENTRFFTEVLGFRLTEQVVLGDGKEQAAAWLSVS  191 (303)
T ss_pred             eEEeCCHHHHHHHHHHhcCCEEEeeEEcCCCcEEEEEEEEcC
Confidence            378999999999999999999876654444332 45566543


No 40 
>PRK06724 hypothetical protein; Provisional
Probab=97.99  E-value=1.7e-05  Score=48.88  Aligned_cols=40  Identities=20%  Similarity=0.437  Sum_probs=27.0

Q ss_pred             CeeecChHHHHHHHhhhc---CCEEEEEEeCCCCeEEEEEecc
Q 036707            1 MFRIKDPKVSLDFYSRVL---GMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vL---G~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      +|.|+|+++|++||+++|   |++.........++..+++...
T Consensus        12 ~l~V~Dle~s~~FY~~vlg~lg~~~~~~~~~~~g~~~l~l~~~   54 (128)
T PRK06724         12 EFWVANLEESISFYDMLFSIIGWRKLNEVAYSTGESEIYFKEV   54 (128)
T ss_pred             EEEeCCHHHHHHHHHHHHhhCCcEEeeeEeeeCCCeeEEEecC
Confidence            389999999999999965   7776533233344445555443


No 41 
>PLN02300 lactoylglutathione lyase
Probab=97.99  E-value=1.6e-05  Score=54.44  Aligned_cols=41  Identities=39%  Similarity=0.832  Sum_probs=33.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYE   41 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g   41 (67)
                      +|.|.|+++|.+||+++||+++..+...+..++.+++++++
T Consensus       159 ~l~~~d~~~a~~Fy~~~lg~~~~~~~~~~~~~~~~~~~~~~  199 (286)
T PLN02300        159 MLRVGDLDRSIKFYEKAFGMKLLRKRDNPEYKYTIAMMGYG  199 (286)
T ss_pred             EEEeCCHHHHHHHHHhccCCEEEeeecccccceEEEEEecC
Confidence            47899999999999999999998766555556888888754


No 42 
>PRK04101 fosfomycin resistance protein FosB; Provisional
Probab=97.98  E-value=1.2e-05  Score=49.23  Aligned_cols=25  Identities=36%  Similarity=0.751  Sum_probs=22.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||+++|||++..+
T Consensus         9 ~L~v~Dl~~s~~FY~~~lG~~~~~~   33 (139)
T PRK04101          9 CFSVSNLEKSIEFYEKVLGAKLLVK   33 (139)
T ss_pred             EEEecCHHHHHHHHHhccCCEEEee
Confidence            3789999999999999999999754


No 43 
>PF12681 Glyoxalase_2:  Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A ....
Probab=97.98  E-value=9.6e-06  Score=46.61  Aligned_cols=24  Identities=25%  Similarity=0.530  Sum_probs=22.5

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|+++|++||+++|||++...
T Consensus         1 l~v~d~~~a~~FY~~~lg~~~~~~   24 (108)
T PF12681_consen    1 LPVSDLEAAAAFYEDVLGFEVVFD   24 (108)
T ss_dssp             EEESSHHHHHHHHHHTTTSEEEEE
T ss_pred             CccCCHHHHHHHHHHhcCCEEEEe
Confidence            689999999999999999999884


No 44 
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.98  E-value=1.7e-05  Score=46.34  Aligned_cols=25  Identities=28%  Similarity=0.586  Sum_probs=22.8

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|+|.|+++|++||+++|||++..+
T Consensus         5 ~l~v~d~~~s~~Fy~~~lG~~~~~~   29 (122)
T cd08354           5 ALYVDDLEAAEAFYEDVLGLELMLK   29 (122)
T ss_pred             EEEeCCHHHHHHHHHhccCCEEeec
Confidence            4899999999999999999999764


No 45 
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins. ChaP is an enzyme involved in the biosynthesis of the potent antitumor agent chartreusin (cha). Cha is an aromatic polyketide glycoside produced by Streptomyces chartreusis. ChaP may play a role as a meta-cleavage dioxygenase in the oxidative rearrangement of the anthracyclic polyketide. ChaP belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=97.98  E-value=6e-06  Score=49.32  Aligned_cols=25  Identities=28%  Similarity=0.614  Sum_probs=22.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|+|+|+++|++||+++||+++...
T Consensus         9 ~l~v~Dl~~s~~FY~~~lG~~~~~~   33 (123)
T cd08351           9 IVPARDREASAEFYAEILGLPWAKP   33 (123)
T ss_pred             EEEcCCHHHHHHHHHHhcCCEeeec
Confidence            3789999999999999999998763


No 46 
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=97.97  E-value=1.6e-05  Score=48.25  Aligned_cols=26  Identities=23%  Similarity=0.500  Sum_probs=22.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      +|.|+|+++|++||++ |||++..+..
T Consensus         8 ~i~v~Dl~~s~~FY~~-LG~~~~~~~~   33 (142)
T cd08353           8 GIVVRDLEAAIAFFLE-LGLELEGRAE   33 (142)
T ss_pred             EEEeCCHHHHHHHHHH-cCCEEccccc
Confidence            4889999999999998 9999876543


No 47 
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.97  E-value=7.5e-06  Score=48.17  Aligned_cols=25  Identities=24%  Similarity=0.493  Sum_probs=22.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|++||+++|||++...
T Consensus         5 ~l~v~D~~~s~~FY~~~lG~~~~~~   29 (125)
T cd07264           5 IIYVEDVEKTLEFYERAFGFERRFL   29 (125)
T ss_pred             EEEEcCHHHHHHHHHHhhCCeEEee
Confidence            4789999999999999999998653


No 48 
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp. NF100 MhqB and similar proteins; MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. This subfamily contains the C-terminal, catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=97.96  E-value=8.3e-06  Score=49.62  Aligned_cols=26  Identities=23%  Similarity=0.466  Sum_probs=23.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|.|+++|++||+++|||++..+.
T Consensus         8 ~l~v~dl~~s~~FY~~vlGl~~~~~~   33 (134)
T cd08360           8 VLFVPDVEAAEAFYRDRLGFRVSDRF   33 (134)
T ss_pred             EEEcCCHHHHHHHHHHhcCCEEEEEe
Confidence            47899999999999999999987654


No 49 
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.96  E-value=7.2e-06  Score=48.57  Aligned_cols=25  Identities=32%  Similarity=0.638  Sum_probs=22.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||+++||+++..+
T Consensus         7 ~l~v~D~~~a~~FY~~~lG~~~~~~   31 (120)
T cd09011           7 LLVVKDIEKSKKFYEKVLGLKVVMD   31 (120)
T ss_pred             EEEECCHHHHHHHHHHhcCCEEeec
Confidence            3789999999999999999998653


No 50 
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the C-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dio
Probab=97.96  E-value=1.7e-05  Score=49.40  Aligned_cols=25  Identities=24%  Similarity=0.466  Sum_probs=22.4

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|+|.|+++|++||+++|||++..+
T Consensus         9 ~i~V~Dle~s~~FY~~~LG~~~~~~   33 (144)
T cd07239           9 VLNSPDVDKTVAFYEDVLGFRVSDW   33 (144)
T ss_pred             EEECCCHHHHHHHHHhcCCCEEEEe
Confidence            3789999999999999999998654


No 51 
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=97.94  E-value=3e-05  Score=45.04  Aligned_cols=26  Identities=23%  Similarity=0.512  Sum_probs=23.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|.|+++|++||+++|||++..+.
T Consensus         8 ~l~v~d~~~a~~fy~~~lG~~~~~~~   33 (125)
T cd08352           8 AIICSDYEKSKEFYVEILGFKVIREV   33 (125)
T ss_pred             EEEcCCHHHHHHHHHHhcCCEEeeee
Confidence            47899999999999999999987653


No 52 
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism]
Probab=97.92  E-value=2.4e-06  Score=59.69  Aligned_cols=39  Identities=28%  Similarity=0.635  Sum_probs=31.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDT   43 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~~   43 (67)
                      ||+|.||++|++||++.|||++.+..    .+.+.+.|+++++
T Consensus       154 ~l~VgdL~ks~kyw~~~lgM~ileke----ek~t~~~mgYgd~  192 (299)
T KOG2943|consen  154 MLNVGDLQKSIKYWEKLLGMKILEKE----EKYTRARMGYGDE  192 (299)
T ss_pred             EEEehhHHHHHHHHHHHhCcchhhhh----hhhhhhhhccCCc
Confidence            68999999999999999999998742    2346677777764


No 53 
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structure of this family is a that of a strand-swapped dimer.
Probab=97.91  E-value=1.1e-05  Score=47.03  Aligned_cols=24  Identities=29%  Similarity=0.693  Sum_probs=21.8

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLK   24 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~   24 (67)
                      +|.|+|+++|++||+++|||++..
T Consensus         5 ~l~v~Dl~~s~~FY~~~lG~~~~~   28 (112)
T cd07238           5 NLPVADPEAAAAFYADVLGLDVVM   28 (112)
T ss_pred             eEecCCHHHHHHHHHHhcCceEEE
Confidence            478999999999999999999864


No 54 
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.91  E-value=1.7e-05  Score=46.72  Aligned_cols=25  Identities=44%  Similarity=0.796  Sum_probs=22.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|.|+++|++||+++|||++..+
T Consensus         7 ~l~v~d~~~~~~Fy~~~lG~~~~~~   31 (125)
T cd07255           7 TLRVADLERSLAFYQDVLGLEVLER   31 (125)
T ss_pred             EEEECCHHHHHHHHHhccCcEEEEc
Confidence            3789999999999999999999765


No 55 
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1. This subfamily family contains FosX, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-Nacetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosX catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of the configuration at C1 in the presence of Mn(II). The hydrated fosfomycin loses the inhibition activity. FosX is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=97.91  E-value=1.3e-05  Score=48.81  Aligned_cols=24  Identities=13%  Similarity=0.225  Sum_probs=22.0

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|+++|++||+++|||++..+
T Consensus        10 l~V~dl~~s~~FY~~~lG~~~~~~   33 (131)
T cd08364          10 LIVKDLNKTTAFLQNIFNAREVYS   33 (131)
T ss_pred             EEeCCHHHHHHHHHHHhCCeeEEe
Confidence            789999999999999999988655


No 56 
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The structures of this family demonstrate  domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.
Probab=97.90  E-value=1.2e-05  Score=47.09  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=22.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||+++||+++..+
T Consensus         6 ~l~v~D~~~s~~FY~~~lG~~~~~~   30 (119)
T cd08359           6 VIVTDDLAETADFYVRHFGFTVVFD   30 (119)
T ss_pred             EEEECCHHHHHHHHHHhhCcEEEec
Confidence            3789999999999999999998764


No 57 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=97.90  E-value=1.5e-05  Score=47.45  Aligned_cols=26  Identities=31%  Similarity=0.530  Sum_probs=23.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .|.|+|+++|++||+++|||++..+.
T Consensus         6 ~l~v~d~~~~~~FY~~vLG~~~~~~~   31 (121)
T cd07244           6 TLAVSDLERSVAFYVDLLGFKLHVRW   31 (121)
T ss_pred             EEEECCHHHHHHHHHHhcCCEEEEec
Confidence            37899999999999999999987654


No 58 
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.88  E-value=9e-06  Score=47.36  Aligned_cols=25  Identities=24%  Similarity=0.316  Sum_probs=22.7

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|.+||+++|||++..+
T Consensus         3 ~l~v~d~~~a~~FY~~~lg~~~~~~   27 (121)
T cd07251           3 TLGVADLARSRAFYEALLGWKPSAD   27 (121)
T ss_pred             eEeeCCHHHHHHHHHHhcCceeccc
Confidence            4789999999999999999998755


No 59 
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase. Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances.
Probab=97.88  E-value=2.8e-05  Score=52.80  Aligned_cols=42  Identities=31%  Similarity=0.589  Sum_probs=30.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeC--CCC-eEEEEEeccCC
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDF--PEM-KFSLYFLGYED   42 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~--~~~-~~~l~fL~~g~   42 (67)
                      +|+|.|+++|++||+++|||++..+...  +++ .+.++|+..++
T Consensus       147 ~l~v~Dle~s~~FY~~~LGf~~~~~~~~~~~~g~~~~~~~l~~~~  191 (286)
T TIGR03213       147 VLRVPDVDAALAFYTEVLGFQLSDVIDLPAGPGVTVRPYFLHCNE  191 (286)
T ss_pred             EEEcCCHHHHHHHHHHccCCeEEEeEcccCCCCCcceEEEEEECC
Confidence            3799999999999999999998765432  222 12456776543


No 60 
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. The enzyme from Bacillus brevis contains manganese.
Probab=97.87  E-value=4.4e-05  Score=51.65  Aligned_cols=39  Identities=21%  Similarity=0.284  Sum_probs=30.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEecc
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      |.|.|+++|++||+++|||++..+...+.+.+...|+..
T Consensus       142 l~v~dl~~a~~Fy~~~lG~~~~~~~~~~~~~~~~~~~~~  180 (294)
T TIGR02295       142 VFVPDVQRALRFYKEELGFRVTEYTEDDEGNLAAAWLHR  180 (294)
T ss_pred             EEeCCHHHHHHHHHHhcCCEEEEEeccCCCcEEEEEEec
Confidence            789999999999999999999776544444555566643


No 61 
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1.13.11.39) from Rhodococcus globerulus P6, BphC2-RGP6 and BphC3-RGP6,  and similar proteins. This subfamily contains Rhodococcus globerulus P6 BphC2-RGP6 and BphC3-RGP6, and similar proteins. BphC catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, yielding 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoic acid. This is the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). This subfamily of BphCs belongs to the type I extradiol dioxygenase family, which require a metal in the active site in its catalytic mechanism. Most type I extradiol dioxygenases are activated by Fe(II). Polychlorinated biphenyl degrading bacteria demonstrate a multiplicity of BphCs. For example, three types of BphC enzymes have been found in Rhodococcus globerulus (BphC1-RGP6 - BphC3-RGP6), all three enzymes are type I extradiol dioxygenases. BphC2-RGP6 and BphC3-RGP6 are 
Probab=97.83  E-value=1.9e-05  Score=47.40  Aligned_cols=26  Identities=27%  Similarity=0.566  Sum_probs=23.0

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|+|.|+++|++||+++|||++..+.
T Consensus         6 ~l~v~D~~~s~~FY~~~lG~~~~~~~   31 (134)
T cd08348           6 VLYVRDLEAMVRFYRDVLGFTVTDRG   31 (134)
T ss_pred             EEEecCHHHHHHHHHHhcCCEEEeec
Confidence            47899999999999999999987653


No 62 
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.82  E-value=1e-05  Score=47.24  Aligned_cols=25  Identities=32%  Similarity=0.664  Sum_probs=22.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      +|.|+|+++|++||+++||+++...
T Consensus         3 ~l~v~d~~~a~~FY~~~lg~~~~~~   27 (114)
T cd07261           3 LLYVEDPAASAEFYSELLGREPVEL   27 (114)
T ss_pred             EEEECCHHHHHHHHHHHcCCCccCC
Confidence            4789999999999999999998653


No 63 
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. The C-terminal domain of Sphingobium chlorophenolicum (formerly Sphingomonas chlorophenolica) 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins. PcpA is a key enzyme in the pentachlorophenol (PCP) degradation pathway, catalyzing the conversion of 2,6-dichloro-p-hydroquinone to 2-chloromaleylacetate. This domain belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.
Probab=97.82  E-value=2e-05  Score=49.99  Aligned_cols=26  Identities=23%  Similarity=0.510  Sum_probs=23.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|+|+++|++||+++|||++..+.
T Consensus         6 ~i~V~Dle~s~~FY~~~LG~~~~~~~   31 (157)
T cd08347           6 TLTVRDPEATAAFLTDVLGFREVGEE   31 (157)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEEeee
Confidence            47899999999999999999997654


No 64 
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain. This family contains the N-terminal, non-catalytic, domain of type I, class II extradiol dioxygenases. Dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. Two major groups of dioxygenases have been identified according to the cleavage site; extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon, whereas intradiol enzymes cleave the aromatic ring between two hydroxyl groups. Extradiol dioxygenases are classified into type I and type II enzymes. Type I extradiol dioxygenases include class I and class II enzymes. These two classes of enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. The extradiol dioxygenases represented in this fa
Probab=97.82  E-value=1.7e-05  Score=46.00  Aligned_cols=26  Identities=35%  Similarity=0.687  Sum_probs=23.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .|.|+|+++|++||+++|||++..+.
T Consensus         7 ~l~v~d~~~~~~FY~~~lg~~~~~~~   32 (117)
T cd07240           7 ELEVPDLERALEFYTDVLGLTVLDRD   32 (117)
T ss_pred             EEecCCHHHHHHHHHhccCcEEEeec
Confidence            37899999999999999999998654


No 65 
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain clas
Probab=97.81  E-value=7.7e-05  Score=41.45  Aligned_cols=27  Identities=30%  Similarity=0.535  Sum_probs=23.7

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      .|.|+|+++|++||+++||+++.....
T Consensus         3 ~i~~~d~~~~~~fy~~~lg~~~~~~~~   29 (112)
T cd06587           3 GLTVSDLEAAVAFYEEVLGFEVLFRNG   29 (112)
T ss_pred             ceeeCCHHHHHHHHHhccCCEEEEeec
Confidence            378999999999999999999877653


No 66 
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins. 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC) catalyzes the extradiol ring cleavage reaction of 2,3-dihydroxybiphenyl, the third step in the polychlorinated biphenyls (PCBs) degradation pathway (bph pathway). The enzyme contains a N-terminal and a C-terminal domain of similar structure fold, resulting from an ancient gene duplication. BphC belongs to the type I extradiol dioxygenase family, which requires a metal in the active site for its catalytic activity. Polychlorinated biphenyl degrading bacteria demonstrate multiplicity of BphCs. Bacterium Rhodococcus rhodochrous K37 has eight genes encoding BphC enzymes. This family includes the N-terminal domain of BphC5-RrK37. The crystal structure of the protein from Novosphingobium aromaticivorans has a Mn(II)in the active site, although most proteins of type I extradiol dioxyge
Probab=97.80  E-value=2.3e-05  Score=45.86  Aligned_cols=24  Identities=25%  Similarity=0.530  Sum_probs=21.9

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|+++|++||+++|||++..+
T Consensus         9 l~v~d~~~s~~FY~~~lG~~~~~~   32 (120)
T cd08362           9 LGVPDLAAAAAFYREVWGLSVVAE   32 (120)
T ss_pred             EecCCHHHHHHHHHhCcCcEEEEe
Confidence            789999999999999999998654


No 67 
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase. This subfamily contains the N-terminal, non-catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.
Probab=97.79  E-value=2.2e-05  Score=46.31  Aligned_cols=24  Identities=21%  Similarity=0.373  Sum_probs=21.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|.|+++|++||++ |||++..+
T Consensus         8 ~l~v~Dl~~s~~FY~~-lGl~~~~~   31 (113)
T cd07267           8 RFEHPDLDKAERFLTD-FGLEVAAR   31 (113)
T ss_pred             EEccCCHHHHHHHHHH-cCCEEEEe
Confidence            3789999999999999 99998655


No 68 
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases.
Probab=97.79  E-value=2.5e-05  Score=44.20  Aligned_cols=26  Identities=35%  Similarity=0.507  Sum_probs=22.8

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|.|++++++||+++|||++..+.
T Consensus         5 ~l~v~d~~~~~~FY~~~lG~~~~~~~   30 (114)
T cd07245           5 ALRVPDLEASRAFYTDVLGLEEGPRP   30 (114)
T ss_pred             EEecCCHHHHHHHHHHccCCcccCcC
Confidence            47899999999999999999987553


No 69 
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and types I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=97.77  E-value=2.1e-05  Score=46.34  Aligned_cols=25  Identities=28%  Similarity=0.575  Sum_probs=22.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|+|+|+++|++||+++||++...+
T Consensus         6 ~l~v~d~~~a~~FY~~~lG~~~~~~   30 (120)
T cd07254           6 ALNVDDLEASIAFYSKLFGVEPTKV   30 (120)
T ss_pred             EEEeCCHHHHHHHHHHHhCCeEecc
Confidence            3789999999999999999988654


No 70 
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=97.76  E-value=2.4e-05  Score=45.47  Aligned_cols=26  Identities=38%  Similarity=0.742  Sum_probs=23.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .|.|.|+++|++||+++|||++..+.
T Consensus         8 ~l~v~d~~~s~~Fy~~~lG~~~~~~~   33 (125)
T cd07253           8 VLTVADIEATLDFYTRVLGMEVVRFG   33 (125)
T ss_pred             EEEecCHHHHHHHHHHHhCceeeccc
Confidence            37899999999999999999997654


No 71 
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin. This subfamily family contains FosB, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-Nacetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosB catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin, (1R,2S)-epoxypropylphosphonic acid, rendering it inactive. FosB is evolutionarily related to glyoxalase I and type I extradiol dioxygenases
Probab=97.73  E-value=2.6e-05  Score=47.53  Aligned_cols=25  Identities=28%  Similarity=0.444  Sum_probs=22.3

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||+++|||++..+
T Consensus         5 ~l~V~Dl~~a~~FY~~~LG~~~~~~   29 (131)
T cd08363           5 TFSVSNLDKSISFYKHVFMEKLLVL   29 (131)
T ss_pred             EEEECCHHHHHHHHHHhhCCEEecc
Confidence            3789999999999999999998653


No 72 
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the N-terminal, non-catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a differ
Probab=97.71  E-value=3e-05  Score=45.65  Aligned_cols=24  Identities=33%  Similarity=0.574  Sum_probs=21.9

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|.|+++|++||+++|||++..+
T Consensus        10 l~v~d~~~~~~Fy~~~lG~~~~~~   33 (121)
T cd07266          10 LRVTDLEKSREFYVDVLGLVETEE   33 (121)
T ss_pred             EEcCCHHHHHHHHHhccCCEEecc
Confidence            789999999999999999998654


No 73 
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II).  The protein superfamily contains members with or without domain swapping.
Probab=97.70  E-value=3.4e-05  Score=45.86  Aligned_cols=25  Identities=28%  Similarity=0.539  Sum_probs=21.1

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      |.|+|+++|++||++ |||++..+..
T Consensus         6 l~V~Dl~~s~~FY~~-lGf~~~~~~~   30 (124)
T cd09012           6 LPVKDLEKSTAFYTA-LGFEFNPQFS   30 (124)
T ss_pred             eecCCHHHHHHHHHH-CCCEEccccC
Confidence            789999999999976 9999875443


No 74 
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.67  E-value=3.6e-05  Score=45.71  Aligned_cols=24  Identities=33%  Similarity=0.398  Sum_probs=21.2

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|+|+++|++||++ |||++..+
T Consensus         6 ~l~v~Dl~~s~~FY~~-LGf~~~~~   29 (113)
T cd08356           6 FIPAKDFAESKQFYQA-LGFELEWE   29 (113)
T ss_pred             ccccccHHHHHHHHHH-hCCeeEec
Confidence            3789999999999987 99999765


No 75 
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=97.60  E-value=6.9e-05  Score=44.36  Aligned_cols=26  Identities=27%  Similarity=0.472  Sum_probs=23.3

Q ss_pred             CeeecChHHHHHHHhhhc---CCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVL---GMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vL---G~~v~~~~   26 (67)
                      +|+|.|+++|++||+++|   ||++..+.
T Consensus         6 ~i~v~d~~~~~~Fy~~~l~~~G~~~~~~~   34 (128)
T cd07242           6 ELTVRDLERSRAFYDWLLGLLGFEEVKEW   34 (128)
T ss_pred             EEEeCCHHHHHHHHHHHHhhcCCEEEEee
Confidence            478999999999999999   99997764


No 76 
>cd07235 MRD Mitomycin C resistance protein (MRD). Mitomycin C (MC) is a naturally occurring antibiotic, and antitumor agent used in the treatment of cancer. Its antitumor activity is exerted primarily through monofunctional and bifunctional alkylation of DNA. MRD binds to MC and functions as a component of the MC exporting system. MC is bound to MRD by a stacking interaction between a His and a Trp. MRD adopts a structural fold similar to bleomycin resistance protein, glyoxalase I, and extradiol dioxygenases; and it has binding sites at an identical location to binding sites in these evolutionarily related enzymes.
Probab=97.56  E-value=5.6e-05  Score=44.52  Aligned_cols=23  Identities=35%  Similarity=0.515  Sum_probs=19.9

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLK   24 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~   24 (67)
                      +|.|+|+++|++||+ .|||++..
T Consensus         5 ~l~V~D~~~a~~FY~-~LGf~~~~   27 (122)
T cd07235           5 GIVVADMAKSLDFYR-RLGFDFPE   27 (122)
T ss_pred             EEEeccHHHHHHHHH-HhCceecC
Confidence            378999999999996 59999854


No 77 
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase. Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances.
Probab=97.56  E-value=4.2e-05  Score=51.91  Aligned_cols=24  Identities=25%  Similarity=0.398  Sum_probs=21.8

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|+++|++||+++|||++..+
T Consensus         9 l~V~Dl~~s~~FY~~~LGl~~~~~   32 (286)
T TIGR03213         9 IGVSDVDAWREFATEVLGMMVASE   32 (286)
T ss_pred             EEeCCHHHHHHHHHhccCcccccC
Confidence            789999999999999999998654


No 78 
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping.
Probab=97.54  E-value=7.7e-05  Score=43.97  Aligned_cols=26  Identities=23%  Similarity=0.391  Sum_probs=22.3

Q ss_pred             CeeecChHHHHHHHhhh---cCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRV---LGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~v---LG~~v~~~~   26 (67)
                      +|+|+|+++|++||+++   |||++..+.
T Consensus         5 ~l~v~d~~~s~~FY~~~f~~lg~~~~~~~   33 (123)
T cd07262           5 TLGVNDLERARAFYDAVLAPLGIKRVMED   33 (123)
T ss_pred             EEecCcHHHHHHHHHHHHhhcCceEEeec
Confidence            48899999999999999   699987543


No 79 
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase. Members of this family all are enzymes active as catechol 2,3 dioxygenase (1.13.11.2), although some members have highly significant activity on catechol derivatives such as 3-methylcatechol, 3-chlorocatechol, and 4-chlorocatechol (see Mars, et al.). This enzyme is also called metapyrocatechase, as it performs a meta-cleavage (an extradiol ring cleavage), in contrast to the ortho-cleavage (intradiol ring cleavage)performed by catechol 1,2-dioxygenase (EC 1.13.11.1), also called pyrocatechase.
Probab=97.52  E-value=8.3e-05  Score=50.67  Aligned_cols=26  Identities=35%  Similarity=0.456  Sum_probs=23.1

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +|.|+|+++|++||+++|||++..+.
T Consensus         9 ~l~V~Dle~s~~FY~~~LG~~~~~~~   34 (303)
T TIGR03211         9 ELRVLDLEESLKHYTDVLGLEETGRD   34 (303)
T ss_pred             EEEeCCHHHHHHHHHHhcCCEEeeec
Confidence            37899999999999999999987653


No 80 
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. The enzyme from Bacillus brevis contains manganese.
Probab=97.51  E-value=0.00011  Score=49.79  Aligned_cols=24  Identities=29%  Similarity=0.528  Sum_probs=22.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|+++|++||+++|||++..+
T Consensus        10 l~v~Dl~~s~~FY~~vLGl~~~~~   33 (294)
T TIGR02295        10 LRVTDLDKSREFYVDLLGFRETES   33 (294)
T ss_pred             EEeCCHHHHHHHHHHccCCEEEEe
Confidence            789999999999999999998765


No 81 
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only]
Probab=97.49  E-value=0.00012  Score=51.17  Aligned_cols=38  Identities=29%  Similarity=0.451  Sum_probs=31.8

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCCCCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYEDTAS   45 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~~~~   45 (67)
                      |+|.|++++.+||+++|||++..+..      .-.|+..|+...
T Consensus       174 L~v~~l~eA~~fY~~~LG~~~~~~~~------~A~F~a~G~YHH  211 (265)
T COG2514         174 LKVADLEEAEQFYEDVLGLEVTARGP------SALFLASGDYHH  211 (265)
T ss_pred             EEeCCHHHHHHHHHHhcCCeeeecCC------cceEEecCCcce
Confidence            78999999999999999999988722      236888888764


No 82 
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=97.49  E-value=0.0001  Score=43.21  Aligned_cols=24  Identities=21%  Similarity=0.528  Sum_probs=20.8

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEE
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .|.|.|+++|++||+ +|||++..+
T Consensus         7 ~l~v~d~~~s~~FY~-~lG~~~~~~   30 (112)
T cd08344           7 ALEVPDLEVARRFYE-AFGLDVREE   30 (112)
T ss_pred             EEecCCHHHHHHHHH-HhCCcEEee
Confidence            378999999999997 799999654


No 83 
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS). HppD and HmaS are non-heme iron-dependent dioxygenases, which modify a common substrate, 4-hydroxyphenylpyruvate (HPP), but yield different products. HPPD catalyzes the second reaction in tyrosine catabolism, the conversion of 4-hydroxyphenylpyruvate to homogentisate (2,5-dihydroxyphenylacetic acid, HG). HmaS converts HPP to 4-hydroxymandelate, a committed step in the formation of hydroxyphenylglycerine, a structural component of nonproteinogenic macrocyclic peptide antibiotics, such as vancomycin. If the emphasis is on catalytic chemistry, HPPD and HmaS are classified as members of a large family of alpha-keto acid dependent mononuclear non-heme iron oxygenases most of which require Fe(II), molecular oxygen, and an alpha-keto acid (typically alpha-ketoglutarate) to either oxygenate or oxidize a third substrate. Both enzymes are exceptions in that they require two, 
Probab=97.42  E-value=0.00028  Score=46.16  Aligned_cols=39  Identities=21%  Similarity=0.321  Sum_probs=28.4

Q ss_pred             eeec--ChHHHHHHHhhhcCCEEEEEEeCCC--CeEEEEEecc
Q 036707            2 FRIK--DPKVSLDFYSRVLGMSLLKRLDFPE--MKFSLYFLGY   40 (67)
Q Consensus         2 l~V~--Dle~Si~FY~~vLG~~v~~~~~~~~--~~~~l~fL~~   40 (67)
                      +.|.  |+++|++||+++|||++..+...++  .+....++..
T Consensus         9 i~V~~~dl~~a~~fY~~~LGf~~~~~~~~~~~~~~~~s~~l~~   51 (191)
T cd07250           9 GNVPDGEMDSWVDFYRKVLGFHRFWSFDIEDPYSGLRSRVLAS   51 (191)
T ss_pred             eecChhHHHHHHHHHHHhhCCceeeEEccCcCcccEEEEEEEC
Confidence            6788  9999999999999999977665332  2334444444


No 84 
>PF14506 CppA_N:  CppA N-terminal; PDB: 3E0R_D.
Probab=97.42  E-value=0.0002  Score=45.28  Aligned_cols=34  Identities=32%  Similarity=0.724  Sum_probs=25.5

Q ss_pred             CeeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEecc
Q 036707            1 MFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         1 ~l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      .|||.|-+.-++||+++|||+++.+..      .+++|+.
T Consensus         5 vlRVnnR~~ni~FY~~~LGfkll~EEn------a~a~lg~   38 (125)
T PF14506_consen    5 VLRVNNRDLNIDFYQKTLGFKLLSEEN------ALAILGD   38 (125)
T ss_dssp             EEEESSHHHHHHHHTTTT--EEEEEET------TEEEEE-
T ss_pred             eEEEcCHHHhHHHHHhccCcEEeeccc------cEEEecC
Confidence            389999999999999999999988743      3456654


No 85 
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only]
Probab=97.14  E-value=0.0018  Score=45.44  Aligned_cols=26  Identities=27%  Similarity=0.650  Sum_probs=23.6

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      |+|+|++.+..||+++||+++..+..
T Consensus        16 L~vrdL~~~~~FY~~ilGL~v~~~~~   41 (265)
T COG2514          16 LNVRDLDSMTSFYQEILGLQVLEETD   41 (265)
T ss_pred             EEeccHHHHHHHHHHhhCCeeeeccC
Confidence            79999999999999999999987643


No 86 
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to 
Probab=96.90  E-value=0.0042  Score=37.51  Aligned_cols=26  Identities=19%  Similarity=0.401  Sum_probs=22.9

Q ss_pred             eee-cChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRI-KDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V-~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      |.+ .|.+++++||+++||.++.....
T Consensus         5 L~~~~~~~eAi~FY~~~fg~~~~~~~~   31 (128)
T cd06588           5 LWFNGNAEEALEFYQSVFGGEITSLTR   31 (128)
T ss_pred             EeeCCCHHHHHHHHHHHhCCEeEEEEE
Confidence            677 89999999999999999987653


No 87 
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only]
Probab=96.89  E-value=0.0022  Score=40.56  Aligned_cols=26  Identities=23%  Similarity=0.506  Sum_probs=22.8

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      |.|.|++++++||.+++|-+.....+
T Consensus        15 i~~~D~~ra~~FY~~vFgW~~~~~~~   40 (127)
T COG3324          15 LPVSDLERAKAFYEKVFGWTFEDYFD   40 (127)
T ss_pred             eecCCHHHHHHHHHHhhCceeccccc
Confidence            67999999999999999999876544


No 88 
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only]
Probab=96.88  E-value=0.0004  Score=44.03  Aligned_cols=24  Identities=25%  Similarity=0.391  Sum_probs=22.0

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|.|++++.+||+++||++.-+.
T Consensus        10 ~pV~Dl~~tr~FYgevlG~~~GRs   33 (138)
T COG3565          10 IPVNDLDETRRFYGEVLGCKEGRS   33 (138)
T ss_pred             eeccccHHHHhhhhhhcccccccc
Confidence            789999999999999999998664


No 89 
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This protein oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic (see PubMed:8000039). In some bacterial species, this enzyme has been studied as a hemolysin.
Probab=96.33  E-value=0.0032  Score=44.52  Aligned_cols=26  Identities=15%  Similarity=0.414  Sum_probs=22.8

Q ss_pred             eeec--ChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRIK--DPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~--Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      |.|.  |+++|+.||+++|||++..+..
T Consensus       164 i~V~~~dl~~~~~fY~~~lGf~~~~~~~  191 (353)
T TIGR01263       164 GNVYRGQMEPWAEFYEKIFGFREIRSFD  191 (353)
T ss_pred             cccCCccHHHHHHHHHHHhCCceeeEEE
Confidence            6677  9999999999999999977655


No 90 
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown]
Probab=96.13  E-value=0.022  Score=36.29  Aligned_cols=29  Identities=31%  Similarity=0.619  Sum_probs=25.3

Q ss_pred             eeec-ChHHHHHHHhhhcCCEEEEEEeCCC
Q 036707            2 FRIK-DPKVSLDFYSRVLGMSLLKRLDFPE   30 (67)
Q Consensus         2 l~V~-Dle~Si~FY~~vLG~~v~~~~~~~~   30 (67)
                      |.++ |-+++++||+++||.++..+...++
T Consensus         6 l~f~gn~~~Al~fY~~vFgae~~~~~~~~d   35 (136)
T COG2764           6 LFFNGNAREALAFYKEVFGAEELKRVPFGD   35 (136)
T ss_pred             EEECCCHHHHHHHHHHHhCceEEEEEEcCc
Confidence            5677 9999999999999999988877655


No 91 
>COG3607 Predicted lactoylglutathione lyase [General function prediction only]
Probab=95.64  E-value=0.0055  Score=39.10  Aligned_cols=24  Identities=29%  Similarity=0.577  Sum_probs=20.2

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      |.|+||++|.+||+ .||++.-.++
T Consensus         9 LPVkDL~~S~~Fy~-alGfk~Npq~   32 (133)
T COG3607           9 LPVKDLEASKAFYT-ALGFKFNPQF   32 (133)
T ss_pred             cchhhHHHHHHHHH-HhCcccCCCc
Confidence            78999999999995 6899985544


No 92 
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This protein oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic (see PubMed:8000039). In some bacterial species, this enzyme has been studied as a hemolysin.
Probab=95.52  E-value=0.037  Score=39.09  Aligned_cols=24  Identities=21%  Similarity=0.436  Sum_probs=22.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |.|+|++++++||++.|||+...+
T Consensus         8 ~~V~D~~~a~~~y~~~LGf~~~~~   31 (353)
T TIGR01263         8 FYVGDAKQAAYYYFTRFGFEKVAK   31 (353)
T ss_pred             EEeCCHHHHHHHHHHhcCCcEEEE
Confidence            789999999999999999999766


No 93 
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed
Probab=95.44  E-value=0.011  Score=43.03  Aligned_cols=21  Identities=24%  Similarity=0.651  Sum_probs=19.2

Q ss_pred             eeecChHHHHHHHhhhcCCEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSL   22 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v   22 (67)
                      |.|+|+++|++||+.+||+..
T Consensus       253 LpV~DL~rS~~FYt~LF~~n~  273 (357)
T PRK01037        253 LEVQDLRRAKKFYSKMFGLEC  273 (357)
T ss_pred             eeeCCHHHHHHHHHHHhCCCC
Confidence            789999999999999988874


No 94 
>PF13468 Glyoxalase_3:  Glyoxalase-like domain; PDB: 3P8A_B.
Probab=94.76  E-value=0.059  Score=34.26  Aligned_cols=39  Identities=10%  Similarity=0.291  Sum_probs=19.4

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEecc
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGY   40 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~   40 (67)
                      +.|+|+++++++|++.|||++...-..+..+..+..+-+
T Consensus         6 ~~v~dl~~a~~~~~~~lGf~~~~gg~h~~~GT~N~li~f   44 (175)
T PF13468_consen    6 IAVRDLDAAVERFEQRLGFTVTPGGEHPGWGTANALIPF   44 (175)
T ss_dssp             EE-TTGGG----GGGS--S--EEEEE-TTT-EEEEEEE-
T ss_pred             EEcCCHHHHHHhhhhcceEeecCCCcCCCCccEEEEEee
Confidence            679999999999999999999877666653444444333


No 95 
>PLN02875 4-hydroxyphenylpyruvate dioxygenase
Probab=93.50  E-value=0.13  Score=37.84  Aligned_cols=41  Identities=5%  Similarity=0.124  Sum_probs=28.6

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCC-----CeEEEEEeccCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPE-----MKFSLYFLGYED   42 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~-----~~~~l~fL~~g~   42 (67)
                      +.|.||+.++.||+++|||+.....+.+.     .+....++..++
T Consensus       186 iaV~~ld~a~~fY~~vlGf~~~~~~d~~~i~~~~sgl~S~vl~sp~  231 (398)
T PLN02875        186 GNVPNLLPAVNYIAGFTGFHEFAEFTAEDVGTVDSGLNSMVLASNN  231 (398)
T ss_pred             echhhHHHHHHHHHHhcCCeeeeeeccccccccccceEEEEEEcCC
Confidence            56789999999999999998876554321     123455555544


No 96 
>PRK10148 hypothetical protein; Provisional
Probab=91.37  E-value=0.4  Score=30.25  Aligned_cols=25  Identities=20%  Similarity=0.506  Sum_probs=20.3

Q ss_pred             eeec-ChHHHHHHHhhhcCCEEEEEE
Q 036707            2 FRIK-DPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         2 l~V~-Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      |.+. |-+++++||+++||-++..+.
T Consensus         7 L~f~g~a~eAi~FY~~~Fgae~~~~~   32 (147)
T PRK10148          7 LSFAGNCADAIAYYQQTLGAELLYKI   32 (147)
T ss_pred             EEeCCCHHHHHHHHHHHhCCEEEEEE
Confidence            4553 799999999999999886543


No 97 
>PF14507 CppA_C:  CppA C-terminal; PDB: 3E0R_D.
Probab=87.80  E-value=0.17  Score=30.95  Aligned_cols=17  Identities=29%  Similarity=0.686  Sum_probs=6.4

Q ss_pred             eeecChHHHHHHHhhhcC
Q 036707            2 FRIKDPKVSLDFYSRVLG   19 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG   19 (67)
                      |+|.| ++|..||++++|
T Consensus        11 LNV~d-~~~~~fy~~~f~   27 (101)
T PF14507_consen   11 LNVPD-AKSQSFYQSIFG   27 (101)
T ss_dssp             EEE-T--T---S--H---
T ss_pred             EeCCC-hhHHHHHHhccc
Confidence            78999 889999999886


No 98 
>PF06983 3-dmu-9_3-mt:  3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A.
Probab=80.87  E-value=2.8  Score=25.40  Aligned_cols=17  Identities=35%  Similarity=0.677  Sum_probs=13.7

Q ss_pred             cChHHHHHHHhhhcCCE
Q 036707            5 KDPKVSLDFYSRVLGMS   21 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~   21 (67)
                      .+-+++++||.++||-.
T Consensus        11 g~a~eA~~fY~~vf~~~   27 (116)
T PF06983_consen   11 GNAEEALEFYKEVFGGS   27 (116)
T ss_dssp             S-HHHHHHHHHHHSTTE
T ss_pred             CCHHHHHHHHHHHcCCC
Confidence            36789999999999953


No 99 
>PF13225 DUF4033:  Domain of unknown function (DUF4033)
Probab=79.82  E-value=5  Score=23.91  Aligned_cols=28  Identities=18%  Similarity=0.517  Sum_probs=23.1

Q ss_pred             HHHHHhhhcCCEEEEEEeCCCCeEEEEE
Q 036707           10 SLDFYSRVLGMSLLKRLDFPEMKFSLYF   37 (67)
Q Consensus        10 Si~FY~~vLG~~v~~~~~~~~~~~~l~f   37 (67)
                      +.+|+++-||+.+.-.-.+++.+-..+|
T Consensus        49 tQ~Ff~~~~Glpl~M~PNfed~SC~~~F   76 (86)
T PF13225_consen   49 TQTFFKEEFGLPLTMEPNFEDFSCQMIF   76 (86)
T ss_pred             hHHHHHhccCCceEecCCCcCcEEEEEc
Confidence            6799999999999888777776666666


No 100
>KOG4657 consensus Uncharacterized conserved protein [Function unknown]
Probab=76.41  E-value=6.2  Score=27.58  Aligned_cols=35  Identities=14%  Similarity=0.262  Sum_probs=23.9

Q ss_pred             cChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            5 KDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      .|+.+++.||.+.||+++..-.   +....+.|-..++
T Consensus       145 a~~~e~a~wy~dyLGleie~~h---gevikfiFTnIdp  179 (246)
T KOG4657|consen  145 ADIHEAASWYNDYLGLEIEAGH---GEVIKFIFTNIDP  179 (246)
T ss_pred             hccHHHHHHHHHhcCceeeecc---CceEEEEEeccCC
Confidence            3777889999999999996432   2235556654443


No 101
>PLN02875 4-hydroxyphenylpyruvate dioxygenase
Probab=66.34  E-value=16  Score=27.05  Aligned_cols=26  Identities=31%  Similarity=0.403  Sum_probs=22.3

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEe
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      +.|.|..++..+|+..|||+.+....
T Consensus         6 f~v~da~~~~~~f~~~~GF~~~a~~~   31 (398)
T PLN02875          6 FWCGDATNTARRFSWGLGMPLVAKSD   31 (398)
T ss_pred             EEcCCHHHHHHHHHHhcCCCeEeecC
Confidence            56899999999999999999876543


No 102
>PF13176 TPR_7:  Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A.
Probab=63.37  E-value=5.9  Score=18.81  Aligned_cols=17  Identities=18%  Similarity=0.524  Sum_probs=13.4

Q ss_pred             ecChHHHHHHHhhhcCC
Q 036707            4 IKDPKVSLDFYSRVLGM   20 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG~   20 (67)
                      ..|.++++++|++.|.+
T Consensus        12 ~g~~~~Ai~~y~~aL~l   28 (36)
T PF13176_consen   12 QGDYEKAIEYYEQALAL   28 (36)
T ss_dssp             CT-HHHHHHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHh
Confidence            46899999999998754


No 103
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only]
Probab=56.09  E-value=11  Score=27.82  Aligned_cols=28  Identities=18%  Similarity=0.419  Sum_probs=22.7

Q ss_pred             eecChHHHHHHHhhhcCCEEEEEEeCCC
Q 036707            3 RIKDPKVSLDFYSRVLGMSLLKRLDFPE   30 (67)
Q Consensus         3 ~V~Dle~Si~FY~~vLG~~v~~~~~~~~   30 (67)
                      ....|+....||+.+||++.++..+.++
T Consensus       176 ~~~~md~w~~FY~~if~~~~~~~fdi~~  203 (363)
T COG3185         176 KAGQMDTWVLFYESLFGFREIQYFDIPG  203 (363)
T ss_pred             chhhHHHHHHHHHHHhCccceeeEeccC
Confidence            3457899999999999999988766533


No 104
>PF13523 Acetyltransf_8:  Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A.
Probab=53.01  E-value=26  Score=20.96  Aligned_cols=26  Identities=19%  Similarity=0.508  Sum_probs=19.1

Q ss_pred             ChHHHHHHHhhhcCCEEEEEEeCCCCe
Q 036707            6 DPKVSLDFYSRVLGMSLLKRLDFPEMK   32 (67)
Q Consensus         6 Dle~Si~FY~~vLG~~v~~~~~~~~~~   32 (67)
                      |=.+|++.|+ .+||+.+.+.+.++..
T Consensus       123 ~N~~~~~~~~-k~GF~~~g~~~~~~~~  148 (152)
T PF13523_consen  123 DNTRAIRLYE-KAGFRKVGEFEFPDKP  148 (152)
T ss_dssp             T-HHHHHHHH-HTT-EEEEEEEESSEE
T ss_pred             CCHHHHHHHH-HcCCEEeeEEECCCCe
Confidence            4568999997 5899999988776644


No 105
>cd00034 ChSh Chromo Shadow Domain,  found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e.g. Drosophila and human heterochromatin protein (HP1) and mammalian modifier 1 and modifier 2)
Probab=52.15  E-value=7  Score=20.89  Aligned_cols=17  Identities=29%  Similarity=0.575  Sum_probs=13.9

Q ss_pred             eecChHHHHHHHhhhcC
Q 036707            3 RIKDPKVSLDFYSRVLG   19 (67)
Q Consensus         3 ~V~Dle~Si~FY~~vLG   19 (67)
                      +.+.+..-++||++-|-
T Consensus        36 ~~k~P~~vI~FYE~~l~   52 (54)
T cd00034          36 NVKCPLLVISFYEEHLT   52 (54)
T ss_pred             HhhCcHHHHHHHHHhcc
Confidence            46788999999998763


No 106
>COG0456 RimI Acetyltransferases [General function prediction only]
Probab=50.15  E-value=26  Score=21.16  Aligned_cols=21  Identities=19%  Similarity=0.513  Sum_probs=16.6

Q ss_pred             ChHHHHHHHhhhcCCEEEEEEe
Q 036707            6 DPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         6 Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      +-..++.||++ +||++..+..
T Consensus       136 ~N~~Ai~lY~~-~GF~~~~~~~  156 (177)
T COG0456         136 SNEAAIGLYRK-LGFEVVKIRK  156 (177)
T ss_pred             CChHHHHHHHH-cCCEEEeeeh
Confidence            45599999976 9999977643


No 107
>smart00300 ChSh Chromo Shadow Domain.
Probab=50.01  E-value=7.5  Score=21.22  Aligned_cols=18  Identities=28%  Similarity=0.549  Sum_probs=14.3

Q ss_pred             eecChHHHHHHHhhhcCC
Q 036707            3 RIKDPKVSLDFYSRVLGM   20 (67)
Q Consensus         3 ~V~Dle~Si~FY~~vLG~   20 (67)
                      +++.+...|+||++-|-+
T Consensus        42 ~~k~P~~vI~FYE~~l~~   59 (61)
T smart00300       42 NVKCPQKVIRFYESHLTF   59 (61)
T ss_pred             HHHChHHHHHHHHHhCcc
Confidence            457889999999987643


No 108
>PF08445 FR47:  FR47-like protein;  InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT). This protein has been found to consist of two N-acyltransferase-like domains swapped with the C-terminal strands. ; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups; PDB: 1SQH_A 3EC4_B.
Probab=47.32  E-value=46  Score=18.74  Aligned_cols=20  Identities=25%  Similarity=0.522  Sum_probs=14.3

Q ss_pred             cChHHHHHHHhhhcCCEEEEE
Q 036707            5 KDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .+-..|+++|+ .|||+...+
T Consensus        63 ~~N~~s~~ly~-klGf~~~~~   82 (86)
T PF08445_consen   63 ADNEASIRLYE-KLGFREIEE   82 (86)
T ss_dssp             TT-HHHHHHHH-HCT-EEEEE
T ss_pred             CCCHHHHHHHH-HcCCEEEEE
Confidence            46678999995 589998754


No 109
>PF15067 FAM124:  FAM124 family
Probab=46.00  E-value=19  Score=25.11  Aligned_cols=24  Identities=13%  Similarity=0.189  Sum_probs=19.8

Q ss_pred             eeec--ChHHHHHHHhhhcCCEEEEE
Q 036707            2 FRIK--DPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         2 l~V~--Dle~Si~FY~~vLG~~v~~~   25 (67)
                      |-|+  |.+.+++||+-+|+=+...+
T Consensus       134 ly~~~~N~~d~vr~Yelil~~~~~~~  159 (236)
T PF15067_consen  134 LYCSFDNYEDMVRFYELILQREPTQQ  159 (236)
T ss_pred             EEecCCCHHHHHHHHHHHhccCccee
Confidence            4566  99999999999999877544


No 110
>PF00515 TPR_1:  Tetratricopeptide repeat;  InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. The X-ray structure of a domain containing three TPRs from protein phosphatase 5 revealed that TPR adopts a helix-turn-helix arrangement, with adjacent TPR motifs packing in a parallel fashion, resulting in a spiral of repeating anti-parallel alpha-helices []. The two helices are denoted helix A and helix B. The packing angle between helix A and helix B is ~24 degrees; within a single TPR and generates a right-handed superhelical shape. Helix A interacts with helix B and with helix A' of the next TPR. Two protein surfaces are generated: the inner concave surface is contributed to mainly by residue on helices A, and the other surface presents residues from both helices A and B. ; GO: 0005515 protein binding; PDB: 3SF4_C 2LNI_A 1ELW_A 2C0M_A 1FCH_B 3R9A_B 2J9Q_A 2C0L_A 1KT1_A 3FWV_A ....
Probab=40.31  E-value=24  Score=15.82  Aligned_cols=15  Identities=33%  Similarity=0.638  Sum_probs=11.6

Q ss_pred             cChHHHHHHHhhhcC
Q 036707            5 KDPKVSLDFYSRVLG   19 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG   19 (67)
                      .+.+.++..|+++|-
T Consensus        15 ~~~~~A~~~~~~al~   29 (34)
T PF00515_consen   15 GDYEEALEYYQRALE   29 (34)
T ss_dssp             T-HHHHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHH
Confidence            578999999998763


No 111
>PF11782 DUF3319:  Protein of unknown function (DUF3319);  InterPro: IPR021753  This is a family of short bacterial proteins, a few of which are annotated as being minor tail protein. Otherwise the function is unknown. 
Probab=38.67  E-value=20  Score=21.48  Aligned_cols=12  Identities=25%  Similarity=0.545  Sum_probs=10.1

Q ss_pred             ChHHHHHHHhhh
Q 036707            6 DPKVSLDFYSRV   17 (67)
Q Consensus         6 Dle~Si~FY~~v   17 (67)
                      -+.+||+|||+.
T Consensus        36 ~vKksIdww~dt   47 (88)
T PF11782_consen   36 EVKKSIDWWCDT   47 (88)
T ss_pred             HHHHHHHHHHhc
Confidence            468999999983


No 112
>PF01393 Chromo_shadow:  Chromo shadow domain Web page maintained by Rein Aasland;  InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain. It is always found in association with a chromo domain.  The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation. These are proteins that alter the structure of chromatin to the condensed morphology of heterochromatin, a cytologically visible condition where gene expression is repressed. In one of these proteins, Polycomb, the chromo domain has been shown to be important for chromatin targeting. Proteins that contain a chromo domain appear to fall into 3 classes. The first class includes proteins having an N-terminal chromo domain followed by a region termed the chromo shadow domain [], eg. Drosophila and human heterochromatin protein Su(var)205 (HP1); and mammalian modifier 1 and modifier 2. The second class includes proteins with a single chromo domain, eg. Drosophila protein Polycomb (Pc); mammalian modifier 3; human Mi-2 autoantigenand and several yeast and Caenorhabditis elegans hypothetical proteins. In the third class paired tandem chromo domains are found, eg. in mammalian DNA-binding/helicase proteins CHD-1 to CHD-4 and yeast protein CHD1.; GO: 0005634 nucleus; PDB: 3Q6S_C 2FMM_B 3P7J_B 1E0B_B 3I3C_A 1DZ1_B 1S4Z_A 3KUP_D.
Probab=36.33  E-value=26  Score=18.97  Aligned_cols=16  Identities=31%  Similarity=0.428  Sum_probs=12.6

Q ss_pred             ecChHHHHHHHhhhcC
Q 036707            4 IKDPKVSLDFYSRVLG   19 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG   19 (67)
                      .+-+...++||++-|=
T Consensus        40 ~k~Pq~vI~FYE~~l~   55 (58)
T PF01393_consen   40 EKCPQKVIKFYESHLV   55 (58)
T ss_dssp             HHSHHHHHHHHHHTCE
T ss_pred             HHCcHHHHHHHHHHee
Confidence            3568889999998764


No 113
>PRK10514 putative acetyltransferase; Provisional
Probab=36.04  E-value=69  Score=18.73  Aligned_cols=20  Identities=20%  Similarity=0.484  Sum_probs=15.2

Q ss_pred             ChHHHHHHHhhhcCCEEEEEE
Q 036707            6 DPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         6 Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +-.+|++||+ .+||+...+.
T Consensus       108 ~N~~a~~~ye-k~Gf~~~~~~  127 (145)
T PRK10514        108 QNEQAVGFYK-KMGFKVTGRS  127 (145)
T ss_pred             CCHHHHHHHH-HCCCEEeccc
Confidence            3468999995 6899986543


No 114
>PHA03397 vlf-1 very late expression factor 1; Provisional
Probab=33.69  E-value=25  Score=25.75  Aligned_cols=16  Identities=19%  Similarity=0.766  Sum_probs=14.4

Q ss_pred             ChHHHHHHHhhhcCCE
Q 036707            6 DPKVSLDFYSRVLGMS   21 (67)
Q Consensus         6 Dle~Si~FY~~vLG~~   21 (67)
                      -|..++.|||..+|+.
T Consensus       124 ~l~~~~~~y~~~~~l~  139 (363)
T PHA03397        124 TLQLTINFYTNAMGLP  139 (363)
T ss_pred             HHHHHHHHHHccCCCC
Confidence            4788999999999988


No 115
>PF04761 Phage_Treg:  Lactococcus bacteriophage putative transcription regulator;  InterPro: IPR006848 This family represents a number of putative transcription repressor proteins found in several Lactococcus bacteriophages. Horizontal transfer may account for the presence of similar proteins in Lactococcus species [].
Probab=33.54  E-value=29  Score=18.89  Aligned_cols=12  Identities=33%  Similarity=0.675  Sum_probs=9.5

Q ss_pred             HHHHHHHhhhcC
Q 036707            8 KVSLDFYSRVLG   19 (67)
Q Consensus         8 e~Si~FY~~vLG   19 (67)
                      ..|++||.+.|-
T Consensus        16 q~sve~yk~kl~   27 (57)
T PF04761_consen   16 QESVEFYKEKLS   27 (57)
T ss_pred             HHHHHHHHHHHH
Confidence            578999988763


No 116
>PF13181 TPR_8:  Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A ....
Probab=33.08  E-value=40  Score=14.90  Aligned_cols=16  Identities=19%  Similarity=0.559  Sum_probs=12.6

Q ss_pred             ecChHHHHHHHhhhcC
Q 036707            4 IKDPKVSLDFYSRVLG   19 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG   19 (67)
                      ..|.+.|++.|.+++-
T Consensus        14 ~~~~~~A~~~~~~a~~   29 (34)
T PF13181_consen   14 LGDYEEALEYFEKALE   29 (34)
T ss_dssp             TTSHHHHHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHh
Confidence            3588999999988763


No 117
>PF13420 Acetyltransf_4:  Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A ....
Probab=31.48  E-value=63  Score=19.06  Aligned_cols=22  Identities=23%  Similarity=0.442  Sum_probs=16.7

Q ss_pred             cChHHHHHHHhhhcCCEEEEEEe
Q 036707            5 KDPKVSLDFYSRVLGMSLLKRLD   27 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~v~~~~~   27 (67)
                      .+=.+|++||+ .+||+...+..
T Consensus       120 ~~N~~~i~~~~-~~GF~~~g~~~  141 (155)
T PF13420_consen  120 SSNEKAINFYK-KLGFEEEGELK  141 (155)
T ss_dssp             TT-HHHHHHHH-HTTEEEEEEEE
T ss_pred             cCCHHHHHHHH-hCCCEEEEEEe
Confidence            45678999995 59999987654


No 118
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis]
Probab=31.03  E-value=1.3e+02  Score=21.40  Aligned_cols=41  Identities=15%  Similarity=0.242  Sum_probs=29.8

Q ss_pred             eeecChHHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +-+.|.+....|..+.||+.++-......++..++.+..++
T Consensus       138 ~i~~~~~~~~~~~~~~~g~pvVlKp~~Gs~G~gV~~v~~~d  178 (318)
T COG0189         138 LITRDPDEAAEFVAEHLGFPVVLKPLDGSGGRGVFLVEDAD  178 (318)
T ss_pred             EEEcCHHHHHHHHHHhcCCCEEEeeCCCCCccceEEecCCC
Confidence            45678899999999999999988766555554555554444


No 119
>smart00671 SEL1 Sel1-like repeats. These represent a subfamily of TPR (tetratricopeptide repeat) sequences.
Probab=30.48  E-value=46  Score=14.78  Aligned_cols=13  Identities=31%  Similarity=0.736  Sum_probs=11.0

Q ss_pred             cChHHHHHHHhhh
Q 036707            5 KDPKVSLDFYSRV   17 (67)
Q Consensus         5 ~Dle~Si~FY~~v   17 (67)
                      +|.++++.||+..
T Consensus        19 ~d~~~A~~~~~~A   31 (36)
T smart00671       19 KDLEKALEYYKKA   31 (36)
T ss_pred             cCHHHHHHHHHHH
Confidence            5899999999875


No 120
>PF03634 TCP:  TCP family transcription factor;  InterPro: IPR005333 The TCP transcription factor family was named after: teosinte branched 1 (tb1, Zea mays (Maize)) [], cycloidea (cyc) (Antirrhinum majus) (Garden snapdragon) [] and PCF in rice (Oryza sativa) [, ]. The TCP proteins code for structurally related proteins implicated in the evolution of key morphological traits []. However, the biochemical function of CYC and TB1 proteins remains to be demonstrated. One of the conserved regions is predicted to form a non-canonical basic-Helix-Loop-Helix (bHLP) structure. This domain is also found in two rice DNA-binding proteins, PCF1 and PCF2, where it has been shown to be involved in DNA-binding and dimerization. This family of transcription factors are exclusive to higher plants. They can be divided into two groups, TCP-C and TCP-P, that appear to have separated following an early gene duplication event []. This duplication event may have led to functional divergence and it has been proposed that that the TCP-P subfamily are transcriptional repressors, while the TPC-C subfamily are transcription activators [].
Probab=30.42  E-value=42  Score=20.71  Aligned_cols=18  Identities=17%  Similarity=0.462  Sum_probs=14.4

Q ss_pred             ChHHHHHHH--hhhcCCEEE
Q 036707            6 DPKVSLDFY--SRVLGMSLL   23 (67)
Q Consensus         6 Dle~Si~FY--~~vLG~~v~   23 (67)
                      .++-+.+||  ++.|||.-.
T Consensus        25 s~~~Ar~FFdLQDmLGfDKa   44 (138)
T PF03634_consen   25 SLEIARKFFDLQDMLGFDKA   44 (138)
T ss_pred             CHHHHHHHHHHHHHhcCCCC
Confidence            588899998  688998653


No 121
>PTZ00330 acetyltransferase; Provisional
Probab=29.75  E-value=69  Score=18.66  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=13.9

Q ss_pred             hHHHHHHHhhhcCCEEEEE
Q 036707            7 PKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         7 le~Si~FY~~vLG~~v~~~   25 (67)
                      -..|++||+ .+||+...+
T Consensus       124 n~~a~~~y~-k~GF~~~~~  141 (147)
T PTZ00330        124 TEDMVAFYK-KLGFRACER  141 (147)
T ss_pred             ChHHHHHHH-HCCCEEece
Confidence            367999995 689998653


No 122
>PF07719 TPR_2:  Tetratricopeptide repeat;  InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]. It mediates protein-protein interactions and the assembly of multiprotein complexes []. The TPR motif consists of 3-16 tandem-repeats of 34 amino acids residues, although individual TPR motifs can be dispersed in the protein sequence. Sequence alignment of the TPR domains reveals a consensus sequence defined by a pattern of small and large amino acids. TPR motifs have been identified in various different organisms, ranging from bacteria to humans. Proteins containing TPRs are involved in a variety of biological processes, such as cell cycle regulation, transcriptional control, mitochondrial and peroxisomal protein transport, neurogenesis and protein folding. This repeat includes outlying Tetratricopeptide-like repeats (TPR) that are not matched by IPR001440 from INTERPRO.; PDB: 1XNF_B 3Q15_A 4ABN_A 1OUV_A 3U4T_A 3MA5_C 2KCV_A 2KCL_A 2XEV_A 3NF1_A ....
Probab=27.32  E-value=53  Score=14.31  Aligned_cols=16  Identities=6%  Similarity=0.482  Sum_probs=11.7

Q ss_pred             ecChHHHHHHHhhhcC
Q 036707            4 IKDPKVSLDFYSRVLG   19 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG   19 (67)
                      ..+.+++++.|++++-
T Consensus        14 ~~~~~~A~~~~~~al~   29 (34)
T PF07719_consen   14 LGNYEEAIEYFEKALE   29 (34)
T ss_dssp             TT-HHHHHHHHHHHHH
T ss_pred             hCCHHHHHHHHHHHHH
Confidence            3578899999988763


No 123
>PRK10562 putative acetyltransferase; Provisional
Probab=27.26  E-value=1.1e+02  Score=18.09  Aligned_cols=21  Identities=14%  Similarity=0.485  Sum_probs=15.8

Q ss_pred             cChHHHHHHHhhhcCCEEEEEE
Q 036707            5 KDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .+=..|++||+ -+||+.....
T Consensus       106 ~~N~~s~~~y~-k~Gf~~~~~~  126 (145)
T PRK10562        106 QKNQRAVNFYH-AQGFRIVDSA  126 (145)
T ss_pred             cCChHHHHHHH-HCCCEEcccc
Confidence            34568999996 5899997654


No 124
>PHA02503 putative transcription regulator; Provisional
Probab=27.16  E-value=44  Score=18.16  Aligned_cols=11  Identities=36%  Similarity=0.724  Sum_probs=8.9

Q ss_pred             HHHHHHHhhhc
Q 036707            8 KVSLDFYSRVL   18 (67)
Q Consensus         8 e~Si~FY~~vL   18 (67)
                      ..|++||.+.|
T Consensus        16 q~sve~yke~l   26 (57)
T PHA02503         16 QESVEFYKEKL   26 (57)
T ss_pred             HHHHHHHHHHH
Confidence            57899998876


No 125
>smart00733 Mterf Mitochondrial termination factor repeats. Human mitochondrial termination factor is a DNA-binding protein that acts as a transcription termination factor. Six repeats occur in human mTERF, that also are present in numerous plant proteins.
Probab=26.50  E-value=35  Score=14.44  Aligned_cols=16  Identities=31%  Similarity=0.461  Sum_probs=12.1

Q ss_pred             ecChHHHHHHHhhhcCC
Q 036707            4 IKDPKVSLDFYSRVLGM   20 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG~   20 (67)
                      +..++..++|++ .+|+
T Consensus        15 ~~~l~~~~~~l~-~~g~   30 (31)
T smart00733       15 EKKLKPKVEFLK-ELGF   30 (31)
T ss_pred             HHHhhHHHHHHH-HcCC
Confidence            456778889998 6776


No 126
>PRK13688 hypothetical protein; Provisional
Probab=26.19  E-value=1.7e+02  Score=18.41  Aligned_cols=18  Identities=28%  Similarity=0.403  Sum_probs=14.2

Q ss_pred             HHHHHHHhhhcCCEEEEEE
Q 036707            8 KVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         8 e~Si~FY~~vLG~~v~~~~   26 (67)
                      ..+++||. .+||+...+.
T Consensus       117 ~~a~~FY~-k~GF~~~~~~  134 (156)
T PRK13688        117 NKSKDFWL-KLGFTPVEYK  134 (156)
T ss_pred             cchHHHHH-hCCCEEeEEe
Confidence            35789996 6999988765


No 127
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase. Sequences in this family are members of the pfam00583 (GNAT) superfamily of acetyltransferases and are proposed to perform a N-acetylation step in the process of pseudaminic acid biosynthesis in Campylobacter species. This gene is commonly observed in apparent operons with other genes responsible for the biosynthesis of pseudaminic acid and as a component of flagellar and exopolysaccharide biosynthesis loci. Significantly, many genomes containing other components of this pathway lack this gene, indicating that some other N-acetyl transferases may be incolved and/or the step is optional, resulting in a non-acetylated pseudaminic acid variant sugar.
Probab=25.37  E-value=86  Score=18.43  Aligned_cols=21  Identities=14%  Similarity=0.210  Sum_probs=16.1

Q ss_pred             cChHHHHHHHhhhcCCEEEEEE
Q 036707            5 KDPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         5 ~Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      .+=.+|++||+ .+||+.....
T Consensus       119 ~~N~~s~~~y~-k~Gf~~~g~~  139 (156)
T TIGR03585       119 EFNNKALKLYE-KFGFEREGVF  139 (156)
T ss_pred             ccCHHHHHHHH-HcCCeEeeee
Confidence            45678999995 5899986643


No 128
>PF02208 Sorb:  Sorbin homologous domain;  InterPro: IPR003127 Sorbin is an active peptide present in the digestive tract, where it has pro-absorptive and anti-secretory effects in different parts of the intestine, including the ability to decrease VIP (vasoactive intestinal peptide) and cholera toxin-induced secretion. It is expressed in some intestinal and pancreatic endocrine tumours in humans []. Sorbin-homology domains are found in adaptor proteins such as vinexin, CAP/ponsin and argBP2, which regulate various cellular functions, including cell adhesion, cytoskeletal organisation, and growth factor signalling []. In addition to the sorbin domain, these proteins contain three SH3 (src homology 3) domains. The sorbin homology domain mediates the interaction of vinexin and CAP with flotillin, which is crucial for the localisation of SH3-binding proteins to the lipid raft, a region of the plasma membrane rich in cholesterol and sphingolipids that acts to concentrate certain signalling molecules. The sorbin homology domain of adaptor proteins may mediate interactions with the lipid raft that are crucial to intracellular communication [].
Probab=25.22  E-value=32  Score=18.27  Aligned_cols=17  Identities=12%  Similarity=0.389  Sum_probs=13.2

Q ss_pred             eeecChHHHHHHHhhhc
Q 036707            2 FRIKDPKVSLDFYSRVL   18 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vL   18 (67)
                      |.+++.+++.+||...+
T Consensus        17 iP~~~vd~~kDWYktMF   33 (47)
T PF02208_consen   17 IPLSNVDRPKDWYKTMF   33 (47)
T ss_pred             CccccccchhHHHHHHH
Confidence            44578899999998754


No 129
>PF08238 Sel1:  Sel1 repeat;  InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway []. Mammalian homologues have since been identified although these mainly pancreatic proteins have yet to have a function assigned.; PDB: 2XM6_A 3RJV_A 1OUV_A 1KLX_A.
Probab=24.76  E-value=39  Score=15.41  Aligned_cols=13  Identities=23%  Similarity=0.572  Sum_probs=10.7

Q ss_pred             cChHHHHHHHhhh
Q 036707            5 KDPKVSLDFYSRV   17 (67)
Q Consensus         5 ~Dle~Si~FY~~v   17 (67)
                      +|+++++.||++.
T Consensus        22 ~d~~~A~~~~~~A   34 (39)
T PF08238_consen   22 KDYEKAFKWYEKA   34 (39)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             ccccchHHHHHHH
Confidence            4889999999864


No 130
>PHA00212 putative transcription regulator
Probab=24.54  E-value=51  Score=18.21  Aligned_cols=11  Identities=27%  Similarity=0.694  Sum_probs=8.9

Q ss_pred             HHHHHHHhhhc
Q 036707            8 KVSLDFYSRVL   18 (67)
Q Consensus         8 e~Si~FY~~vL   18 (67)
                      ..|++||.+.|
T Consensus        18 q~sve~yk~~l   28 (63)
T PHA00212         18 QHSVEWYKKQL   28 (63)
T ss_pred             HHHHHHHHHHH
Confidence            57899998876


No 131
>PRK10140 putative acetyltransferase YhhY; Provisional
Probab=24.11  E-value=95  Score=18.26  Aligned_cols=20  Identities=15%  Similarity=0.252  Sum_probs=15.5

Q ss_pred             ChHHHHHHHhhhcCCEEEEEE
Q 036707            6 DPKVSLDFYSRVLGMSLLKRL   26 (67)
Q Consensus         6 Dle~Si~FY~~vLG~~v~~~~   26 (67)
                      +-.+|++||+ -+||+.....
T Consensus       123 ~N~~a~~~y~-k~GF~~~g~~  142 (162)
T PRK10140        123 DNAPAIKVYK-KYGFEIEGTG  142 (162)
T ss_pred             CCHHHHHHHH-HCCCEEEeec
Confidence            4568999995 6999986653


No 132
>PF05100 Phage_tail_L:  Phage minor tail protein L ;  InterPro: IPR006487 This entry is represented by Bacteriophage lambda, GpL, a minor tail protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=24.07  E-value=1.2e+02  Score=20.73  Aligned_cols=26  Identities=8%  Similarity=0.213  Sum_probs=19.3

Q ss_pred             eeecChHHHH----HHHhhhcCCEEEEEEe
Q 036707            2 FRIKDPKVSL----DFYSRVLGMSLLKRLD   27 (67)
Q Consensus         2 l~V~Dle~Si----~FY~~vLG~~v~~~~~   27 (67)
                      |+|.|+.-++    .-|.+.+|-+|+++..
T Consensus        51 LtVsNi~G~ital~~~~~dlvgAkV~r~~t   80 (206)
T PF05100_consen   51 LTVSNIDGLITALCLQFDDLVGAKVTRRRT   80 (206)
T ss_pred             EEEecccchHHHHHHHhCcccCcEEEEEEE
Confidence            6777766554    5677899999988764


No 133
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism]
Probab=23.21  E-value=91  Score=22.92  Aligned_cols=40  Identities=23%  Similarity=0.361  Sum_probs=27.6

Q ss_pred             eeecChHHHHHHHhhhcCCEEEE-EEeCCCCeEEEEEeccCCCCCCCC
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLK-RLDFPEMKFSLYFLGYEDTASAPA   48 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~-~~~~~~~~~~l~fL~~g~~~~~~~   48 (67)
                      +||+|+.+.++    .+|+...+ .|.   |.|.-.||.+|+....+.
T Consensus       342 ~rv~dlk~~lr----~~~~~pm~iswk---g~~~k~flh~~~~~~~~~  382 (396)
T KOG4410|consen  342 IRVKDLKSELR----KRECTPMSISWK---GHFGKCFLHFGNRKGVPS  382 (396)
T ss_pred             cchHHHHHHHH----hcCCCceeEeee---cCCcceeEecCCccCCCC
Confidence            68999999987    56666543 443   345668999998754433


No 134
>KOG2640 consensus Thioredoxin [Function unknown]
Probab=21.88  E-value=1.7e+02  Score=21.38  Aligned_cols=22  Identities=27%  Similarity=0.461  Sum_probs=17.4

Q ss_pred             ecChHHHHHHHhhhcCCEEEEE
Q 036707            4 IKDPKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         4 V~Dle~Si~FY~~vLG~~v~~~   25 (67)
                      .+|++.-+.||+++++|.+.-.
T Consensus       148 ~r~l~sLv~fy~~i~~~~v~ie  169 (319)
T KOG2640|consen  148 ERDLASLVNFYTEITPMSVLIE  169 (319)
T ss_pred             cccHHHHHHHHHhhccchhccc
Confidence            3688999999999998665443


No 135
>PF07901 DUF1672:  Protein of unknown function (DUF1672);  InterPro: IPR012873 This family is composed of hypothetical bacterial proteins of unknown function. 
Probab=20.75  E-value=2.5e+02  Score=20.06  Aligned_cols=35  Identities=9%  Similarity=0.119  Sum_probs=29.6

Q ss_pred             HHHHHHHhhhcCCEEEEEEeCCCCeEEEEEeccCC
Q 036707            8 KVSLDFYSRVLGMSLLKRLDFPEMKFSLYFLGYED   42 (67)
Q Consensus         8 e~Si~FY~~vLG~~v~~~~~~~~~~~~l~fL~~g~   42 (67)
                      +++++|+.+-+++.|.-....+.+....+|+.+.+
T Consensus        40 k~~~~yfkd~y~t~VKv~NVVga~dga~V~Veced   74 (277)
T PF07901_consen   40 KRAIQYFKDNYKTDVKVTNVVGARDGAVVYVECED   74 (277)
T ss_pred             HHHHHHHHHhcCceeEEEEEEccCCcEEEEEEecC
Confidence            46889999999999987777777778889998875


No 136
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism]
Probab=20.64  E-value=82  Score=23.35  Aligned_cols=23  Identities=22%  Similarity=0.449  Sum_probs=20.4

Q ss_pred             eeecChHHHHHHHhhhcCCEEEE
Q 036707            2 FRIKDPKVSLDFYSRVLGMSLLK   24 (67)
Q Consensus         2 l~V~Dle~Si~FY~~vLG~~v~~   24 (67)
                      +.|.|-..+.+|||.-|||+...
T Consensus        23 F~vgna~q~A~~y~~~fGfep~A   45 (381)
T KOG0638|consen   23 FWVGNAKQAARWYCSGFGFEPLA   45 (381)
T ss_pred             EEecCcHHHHHHHHhhcCCcchh
Confidence            56889999999999999999865


No 137
>PRK10314 putative acyltransferase; Provisional
Probab=20.59  E-value=1e+02  Score=18.97  Aligned_cols=18  Identities=17%  Similarity=0.355  Sum_probs=13.2

Q ss_pred             hHHHHHHHhhhcCCEEEEE
Q 036707            7 PKVSLDFYSRVLGMSLLKR   25 (67)
Q Consensus         7 le~Si~FY~~vLG~~v~~~   25 (67)
                      -..+..||++ +||+.+.+
T Consensus       117 ~~~a~~fY~k-~GF~~~g~  134 (153)
T PRK10314        117 QAHLQNFYQS-FGFIPVTE  134 (153)
T ss_pred             HHHHHHHHHH-CCCEECCC
Confidence            3457899965 99988653


Done!