Citrus Sinensis ID: 036721

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MIAELIGTYFIIFAGCGAVAVDKIYGKVTFPGVCVTWGLIVMVMIYSLAHISGAHFNPAVTIALAIFRQFKRRQVPLYIVAQVVGSLLASGTLSLMLDVTPQAYFGTVPVGSNAQSFVAEIIISFLLMFVISGAVTDDRAIGQFGGVAVGMTIMLNVFVAGPISGASMNPARSIGPAIVKHKFRGIWLYIIGPVIGTVTGGFAYNLIKIHRQANQLHINSSVV
cHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHccccccccccccccc
MIAELIGTYFIIFAGCGAVAVDKIYGKVTFPGVCVTWGLIVMVMIYSLAHISGAHFNPAVTIALAIFRQFKRRQVPLYIVAQVVGSLLASGTLSLMLDVTPQAYFGTVPVGSNAQSFVAEIIISFLLMFVISGAVTDDRAIGQFGGVAVGMTIMLNVFVAGPISGASMNPARSIGPAIVKHKFRGIWLYIIGPVIGTVTGGFAYNLIKIHRQ***********
xxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAELIGTYFIIFAGCGAVAVDKIYGKVTFPGVCVTWGLIVMVMIYSLAHISGAHFNPAVTIALAIFRQFKRRQVPLYIVAQVVGSLLASGTLSLMLDVTPQAYFGTVPVGSNAQSFVAEIIISFLLMFVISGAVTDDRAIGQFGGVAVGMTIMLNVFVAGPISGASMNPARSIGPAIVKHKFRGIWLYIIGPVIGTVTGGFAYNLIKIHRQANQLHINSSVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aquaporin Z Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity.probableQ7NU39
Probable aquaporin NIP-type Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.probableP49173
Probable aquaporin AqpM Channel that permits osmotically driven movement of water in both directions.probableO28846

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C02, chain A
Confidence level:very confident
Coverage over the Query: 1-215
View the alignment between query and template
View the model in PyMOL