Query         036777
Match_columns 66
No_of_seqs    161 out of 1005
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:23:18 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036777.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036777hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2007 Cysteinyl-tRNA synthet 100.0 1.6E-29 3.6E-34  194.5   1.6   63    4-66     22-85  (586)
  2 COG0215 CysS Cysteinyl-tRNA sy  99.9 2.1E-28 4.5E-33  186.0   2.2   52   15-66      1-52  (464)
  3 PTZ00399 cysteinyl-tRNA-synthe  99.9   1E-27 2.2E-32  186.7   1.3   62    5-66     26-90  (651)
  4 PLN02946 cysteine-tRNA ligase   99.9 3.4E-27 7.3E-32  182.0   1.4   59    8-66     52-110 (557)
  5 PRK14536 cysS cysteinyl-tRNA s  99.9 7.2E-27 1.6E-31  177.9   0.3   53   14-66      1-53  (490)
  6 PRK14535 cysS cysteinyl-tRNA s  99.9 8.9E-26 1.9E-30  177.7   0.7   53   14-66    226-278 (699)
  7 PRK14534 cysS cysteinyl-tRNA s  99.9   1E-25 2.2E-30  171.5   0.3   51   14-66      1-51  (481)
  8 TIGR03447 mycothiol_MshC cyste  99.9   3E-25 6.5E-30  166.4   1.2   56    9-66     11-66  (411)
  9 TIGR00435 cysS cysteinyl-tRNA   99.9 6.2E-24 1.3E-28  159.7   0.1   51   16-66      1-51  (465)
 10 PRK00260 cysS cysteinyl-tRNA s  99.9 1.3E-23 2.7E-28  157.5   0.5   53   14-66      1-53  (463)
 11 cd00672 CysRS_core catalytic c  99.8 3.4E-22 7.3E-27  138.2  -0.4   50   17-66      1-50  (213)
 12 PF01406 tRNA-synt_1e:  tRNA sy  99.8 4.5E-21 9.8E-26  139.7  -3.9   38   29-66      1-38  (300)
 13 PRK12418 cysteinyl-tRNA synthe  99.6   2E-17 4.3E-22  123.3  -1.5   37   30-66      2-39  (384)
 14 cd00802 class_I_aaRS_core cata  98.4 1.3E-08 2.7E-13   65.1  -3.3   28   39-66      1-28  (143)
 15 PRK01611 argS arginyl-tRNA syn  98.2 1.3E-07 2.7E-12   71.9  -1.4   34   33-66    109-142 (507)
 16 PRK11893 methionyl-tRNA synthe  98.1 2.4E-07 5.2E-12   69.1  -2.3   30   37-66      3-32  (511)
 17 TIGR00456 argS arginyl-tRNA sy  98.1 2.7E-07 5.8E-12   71.1  -2.8   42   25-66    100-143 (566)
 18 cd00671 ArgRS_core catalytic c  97.8 1.6E-06 3.4E-11   59.2  -2.8   26   41-66      6-31  (212)
 19 cd09287 GluRS_non_core catalyt  97.6 2.5E-06 5.4E-11   60.8  -4.0   26   41-66      5-30  (240)
 20 cd00668 Ile_Leu_Val_MetRS_core  97.6 3.9E-06 8.4E-11   59.7  -3.4   29   38-66      3-31  (312)
 21 PRK12268 methionyl-tRNA synthe  97.5 1.2E-05 2.7E-10   61.1  -1.1   28   39-66      5-35  (556)
 22 cd00818 IleRS_core catalytic c  97.5 4.5E-06 9.8E-11   60.7  -3.7   27   40-66      6-32  (338)
 23 cd00814 MetRS_core catalytic c  97.5 9.5E-06 2.1E-10   58.2  -2.4   27   40-66      5-31  (319)
 24 TIGR00398 metG methionyl-tRNA   97.4   1E-05 2.2E-10   61.2  -2.9   27   40-66      4-30  (530)
 25 PRK04156 gltX glutamyl-tRNA sy  97.2 2.6E-05 5.6E-10   61.3  -2.6   32   34-66     99-130 (567)
 26 PRK12267 methionyl-tRNA synthe  97.1 5.8E-05 1.2E-09   58.9  -2.0   29   38-66      5-35  (648)
 27 PRK00133 metG methionyl-tRNA s  96.9 7.5E-05 1.6E-09   58.7  -3.0   23   44-66     11-33  (673)
 28 cd00812 LeuRS_core catalytic c  96.8 7.9E-05 1.7E-09   53.5  -2.8   26   41-66      6-31  (314)
 29 cd00674 LysRS_core_class_I cat  96.8 0.00012 2.6E-09   54.6  -2.1   29   38-66     21-49  (353)
 30 cd00817 ValRS_core catalytic c  96.8 5.8E-05 1.2E-09   55.7  -4.0   27   40-66      6-32  (382)
 31 PLN02224 methionine-tRNA ligas  96.2 0.00078 1.7E-08   53.3  -0.9   45   22-66     48-100 (616)
 32 PRK00390 leuS leucyl-tRNA synt  96.2 0.00055 1.2E-08   55.1  -2.2   29   38-66     33-63  (805)
 33 PRK00750 lysK lysyl-tRNA synth  96.1  0.0012 2.6E-08   50.9  -0.6   29   38-66     25-53  (510)
 34 TIGR00396 leuS_bact leucyl-tRN  95.6  0.0015 3.2E-08   53.1  -1.9   32   35-66     27-60  (842)
 35 PRK13208 valS valyl-tRNA synth  94.3  0.0046 9.9E-08   49.5  -2.3   31   36-66     39-69  (800)
 36 COG0143 MetG Methionyl-tRNA sy  93.5  0.0065 1.4E-07   47.9  -2.8   24   43-66     13-36  (558)
 37 PF09334 tRNA-synt_1g:  tRNA sy  92.5  0.0034 7.4E-08   46.8  -5.4   24   43-66      7-30  (391)
 38 PLN02610 probable methionyl-tR  90.3   0.028   6E-07   45.8  -2.7   25   42-66     24-49  (801)
 39 TIGR00395 leuS_arch leucyl-tRN  89.8   0.039 8.4E-07   45.4  -2.3   30   37-66     27-56  (938)
 40 PLN02563 aminoacyl-tRNA ligase  89.3   0.046 9.9E-07   45.5  -2.2   32   35-66    108-142 (963)
 41 TIGR00422 valS valyl-tRNA synt  88.3   0.062 1.4E-06   43.5  -2.0   31   36-66     34-64  (861)
 42 TIGR00463 gltX_arch glutamyl-t  88.1    0.03 6.5E-07   44.3  -3.9   25   41-65     97-121 (560)
 43 TIGR00467 lysS_arch lysyl-tRNA  87.8   0.097 2.1E-06   40.9  -1.2   30   37-66     19-48  (515)
 44 PLN02943 aminoacyl-tRNA ligase  86.8   0.054 1.2E-06   44.7  -3.2   30   37-66     90-119 (958)
 45 PTZ00419 valyl-tRNA synthetase  86.4   0.095 2.1E-06   43.3  -2.0   31   36-66     61-91  (995)
 46 TIGR00392 ileS isoleucyl-tRNA   86.4   0.045 9.8E-07   44.2  -3.8   30   37-66     38-67  (861)
 47 PLN02381 valyl-tRNA synthetase  86.4   0.088 1.9E-06   44.1  -2.2   30   37-66    130-159 (1066)
 48 PRK14900 valS valyl-tRNA synth  85.7   0.092   2E-06   43.9  -2.4   31   36-66     49-79  (1052)
 49 COG0495 LeuS Leucyl-tRNA synth  85.4    0.15 3.2E-06   42.2  -1.4   29   38-66     35-65  (814)
 50 PRK05729 valS valyl-tRNA synth  84.6   0.061 1.3E-06   43.7  -3.9   30   37-66     38-67  (874)
 51 PLN02959 aminoacyl-tRNA ligase  84.2    0.11 2.4E-06   43.6  -2.7   29   38-66     46-76  (1084)
 52 PLN02882 aminoacyl-tRNA ligase  83.5     0.1 2.3E-06   44.1  -3.0   31   36-66     39-69  (1159)
 53 PRK05743 ileS isoleucyl-tRNA s  83.2   0.095 2.1E-06   43.0  -3.3   30   37-66     51-80  (912)
 54 KOG2804 Phosphorylcholine tran  82.1    0.37   8E-06   36.5  -0.3   24   33-58     60-83  (348)
 55 PRK06039 ileS isoleucyl-tRNA s  82.0    0.14 3.1E-06   42.3  -2.7   31   36-66     42-72  (975)
 56 PTZ00427 isoleucine-tRNA ligas  82.0    0.17 3.7E-06   43.2  -2.4   31   36-66    103-133 (1205)
 57 PRK13804 ileS isoleucyl-tRNA s  81.9    0.11 2.4E-06   43.0  -3.4   29   38-66     57-85  (961)
 58 PLN02843 isoleucyl-tRNA synthe  80.9    0.14   3E-06   42.5  -3.2   30   37-66     34-63  (974)
 59 cd00853 NifX NifX belongs to a  80.0     1.5 3.2E-05   26.4   1.9   15   49-63     13-27  (102)
 60 PF00133 tRNA-synt_1:  tRNA syn  79.2    0.12 2.7E-06   40.3  -3.8   30   37-66     25-54  (601)
 61 PLN02413 choline-phosphate cyt  77.6       1 2.2E-05   33.5   0.8   23   33-57     24-46  (294)
 62 KOG0435 Leucyl-tRNA synthetase  77.3    0.73 1.6E-05   38.3  -0.1   23   44-66     66-88  (876)
 63 PF00175 NAD_binding_1:  Oxidor  75.7     1.3 2.9E-05   25.8   0.8   13   34-46     90-102 (109)
 64 TIGR02663 nifX nitrogen fixati  74.8     2.5 5.4E-05   26.4   1.9   15   50-64     15-29  (119)
 65 PF08030 NAD_binding_6:  Ferric  74.6     2.3 4.9E-05   26.6   1.7   13   33-45    133-145 (156)
 66 cd00851 MTH1175 This uncharact  73.5     2.8   6E-05   24.6   1.8   16   48-63     14-29  (103)
 67 cd00562 NifX_NifB This CD repr  67.0     3.9 8.6E-05   23.8   1.5   15   49-63     13-27  (102)
 68 cd00852 NifB NifB belongs to a  66.1     4.8  0.0001   24.3   1.7   15   49-63     13-27  (106)
 69 PF02579 Nitro_FeMo-Co:  Dinitr  64.9     6.2 0.00013   22.7   2.0   16   49-64      6-21  (94)
 70 COG0525 ValS Valyl-tRNA synthe  64.0       1 2.2E-05   37.8  -2.0   39   28-66     23-64  (877)
 71 cd02174 CCT CTP:phosphocholine  61.3     4.1 8.8E-05   26.8   0.9   19   36-56      2-20  (150)
 72 PLN02286 arginine-tRNA ligase   59.6     2.9 6.3E-05   32.9  -0.1   32   35-66    117-148 (576)
 73 PF00749 tRNA-synt_1c:  tRNA sy  59.4     1.3 2.7E-05   32.3  -2.0   17   44-60      8-24  (314)
 74 PTZ00308 ethanolamine-phosphat  57.5     4.9 0.00011   30.1   0.8   25   31-57      6-30  (353)
 75 COG0018 ArgS Arginyl-tRNA synt  57.4     2.6 5.6E-05   33.6  -0.7   32   35-66    117-148 (577)
 76 PRK12558 glutamyl-tRNA synthet  56.2     2.1 4.5E-05   33.1  -1.4   17   44-60      9-25  (445)
 77 TIGR03838 queuosine_YadB gluta  55.7    0.62 1.4E-05   33.7  -4.1   18   44-61      7-24  (272)
 78 PRK12451 arginyl-tRNA syntheta  55.5     2.8 6.1E-05   32.8  -0.8   33   34-66    112-144 (562)
 79 KOG0432 Valyl-tRNA synthetase   55.3     1.3 2.9E-05   37.5  -2.7   33   34-66     74-106 (995)
 80 cd00322 FNR_like Ferredoxin re  53.7       8 0.00017   25.1   1.3   12   35-46    190-201 (223)
 81 TIGR03330 SAM_DCase_Bsu S-aden  53.4     8.2 0.00018   24.4   1.3   11   36-46     76-86  (112)
 82 PRK03124 S-adenosylmethionine   53.0     8.4 0.00018   25.0   1.3   11   36-46     77-87  (127)
 83 PRK01706 S-adenosylmethionine   52.6     8.7 0.00019   24.8   1.3   11   36-46     79-89  (123)
 84 PLN02200 adenylate kinase fami  52.2      11 0.00024   26.1   1.9   45    1-45      3-52  (234)
 85 KOG2111 Uncharacterized conser  52.1      24 0.00053   26.9   3.7   37    4-41    194-231 (346)
 86 cd06188 NADH_quinone_reductase  51.9     9.9 0.00021   26.5   1.6   12   35-46    248-259 (283)
 87 cd06200 SiR_like1 Cytochrome p  49.6     9.6 0.00021   26.1   1.2    9   37-45    203-211 (245)
 88 PF00750 tRNA-synt_1d:  tRNA sy  49.4    0.95   2E-05   33.3  -4.0   33   34-66     19-51  (354)
 89 COG0008 GlnS Glutamyl- and glu  49.1     1.2 2.5E-05   34.8  -3.8   19   42-60     14-32  (472)
 90 cd06186 NOX_Duox_like_FAD_NADP  48.8      14  0.0003   24.1   1.8    8   39-46    179-186 (210)
 91 PLN03233 putative glutamate-tR  47.6     1.2 2.6E-05   35.3  -4.0   18   44-61     18-35  (523)
 92 PLN02907 glutamate-tRNA ligase  47.1     1.3 2.7E-05   36.1  -3.9   21   41-61    217-237 (722)
 93 cd06197 FNR_like_2 FAD/NAD(P)   46.6      10 0.00022   25.6   1.0    9   38-46    192-200 (220)
 94 PRK00458 S-adenosylmethionine   45.1      13 0.00029   24.1   1.3   11   36-46     89-99  (127)
 95 PRK02770 S-adenosylmethionine   45.1      13 0.00029   24.6   1.3   11   36-46     90-100 (139)
 96 cd06208 CYPOR_like_FNR These f  44.7      13 0.00029   26.0   1.3   12   35-46    238-249 (286)
 97 TIGR00440 glnS glutaminyl-tRNA  44.5     1.4 3.1E-05   34.8  -3.9   19   43-61      6-24  (522)
 98 cd06190 T4MO_e_transfer_like T  44.2      14 0.00031   24.5   1.3   12   35-46    195-206 (232)
 99 PTZ00402 glutamyl-tRNA synthet  44.0     1.5 3.2E-05   35.4  -3.9   19   43-61     58-76  (601)
100 PRK04025 S-adenosylmethionine   43.9      14 0.00031   24.4   1.3   11   36-46     77-87  (139)
101 PRK05347 glutaminyl-tRNA synth  43.8     1.5 3.2E-05   35.0  -3.9   21   41-61     33-53  (554)
102 cd00418 GlxRS_core catalytic c  43.2     4.1 8.9E-05   28.9  -1.4   18   43-60      7-24  (230)
103 PRK01236 S-adenosylmethionine   43.0      15 0.00033   24.0   1.3   11   36-46     78-88  (131)
104 cd06196 FNR_like_1 Ferredoxin   41.5      18 0.00039   23.7   1.5    9   37-45    187-195 (218)
105 PRK08051 fre FMN reductase; Va  41.0      15 0.00033   24.7   1.1   10   37-46    195-204 (232)
106 cd06198 FNR_like_3 NAD(P) bind  40.1      18 0.00039   23.8   1.4   11   35-45    180-190 (216)
107 cd06189 flavin_oxioreductase N  40.0      19  0.0004   23.9   1.4   11   36-46    190-200 (224)
108 TIGR01290 nifB nitrogenase cof  39.5      20 0.00044   27.4   1.7   26   38-63    330-358 (442)
109 COG1384 LysS Lysyl-tRNA synthe  39.2     2.8 6.1E-05   33.4  -3.0   28   39-66     22-49  (521)
110 cd06182 CYPOR_like NADPH cytoc  39.1      17 0.00037   25.5   1.2    9   38-46    216-224 (267)
111 cd06211 phenol_2-monooxygenase  39.1      19 0.00042   24.1   1.4   11   36-46    204-214 (238)
112 cd06212 monooxygenase_like The  39.0      17 0.00038   24.1   1.2   11   36-46    197-207 (232)
113 cd06187 O2ase_reductase_like T  39.0      20 0.00043   23.5   1.4   13   35-47    189-201 (224)
114 PRK10926 ferredoxin-NADP reduc  38.9      20 0.00043   24.6   1.4   11   36-46    206-216 (248)
115 PRK12410 glutamylglutaminyl-tR  38.7     5.6 0.00012   30.8  -1.4   17   44-60      6-22  (433)
116 cd00808 GluRS_core catalytic c  38.4     5.4 0.00012   28.4  -1.4   18   43-60      7-24  (239)
117 PTZ00319 NADH-cytochrome B5 re  38.4      19 0.00042   25.6   1.4   12   36-47    267-278 (300)
118 PLN03116 ferredoxin--NADP+ red  37.7      18 0.00039   25.8   1.1   10   36-45    259-268 (307)
119 TIGR00464 gltX_bact glutamyl-t  37.5       2 4.3E-05   33.1  -4.0   17   44-60      8-24  (470)
120 cd06165 Sortase_A_1 Sortase A   37.5      63  0.0014   20.0   3.5   17   29-45     97-114 (127)
121 cd06195 FNR1 Ferredoxin-NADP+   37.1      22 0.00047   23.9   1.4   12   35-46    200-211 (241)
122 cd06191 FNR_iron_sulfur_bindin  36.9      18  0.0004   24.0   1.0   10   37-46    198-207 (231)
123 PTZ00437 glutaminyl-tRNA synth  36.7     2.2 4.8E-05   34.2  -3.9   26   34-60     49-74  (574)
124 cd06194 FNR_N-term_Iron_sulfur  36.7      20 0.00043   23.6   1.1   12   35-46    186-197 (222)
125 cd06209 BenDO_FAD_NAD Benzoate  36.6      23  0.0005   23.5   1.4   12   35-46    192-203 (228)
126 PRK05710 glutamyl-Q tRNA(Asp)   36.5     6.1 0.00013   29.1  -1.5   19   42-60     10-28  (299)
127 PRK14703 glutaminyl-tRNA synth  36.3     2.2 4.9E-05   35.2  -4.1   19   42-60     36-54  (771)
128 cd06213 oxygenase_e_transfer_s  36.2      20 0.00044   23.8   1.1   11   36-46    193-203 (227)
129 cd06215 FNR_iron_sulfur_bindin  35.8      21 0.00045   23.5   1.1   10   37-46    198-207 (231)
130 cd06166 Sortase_D_5 Sortase D   35.8      74  0.0016   19.8   3.6   18   27-44     96-114 (126)
131 cd06202 Nitric_oxide_synthase   35.3      22 0.00048   26.5   1.3   11   35-45    349-359 (406)
132 cd06185 PDR_like Phthalate dio  34.8      22 0.00049   23.1   1.2   11   36-46    176-186 (211)
133 cd06217 FNR_iron_sulfur_bindin  34.7      22 0.00049   23.4   1.2   11   36-46    201-211 (235)
134 PF13293 DUF4074:  Domain of un  34.7      22 0.00047   21.1   0.9   15   42-56      3-17  (64)
135 cd06210 MMO_FAD_NAD_binding Me  34.7      22 0.00048   23.6   1.1   10   36-45    201-210 (236)
136 PRK14895 gltX glutamyl-tRNA sy  34.6     2.5 5.3E-05   33.4  -4.0   17   44-60     11-27  (513)
137 cd06216 FNR_iron_sulfur_bindin  34.4      25 0.00055   23.6   1.4   11   36-46    210-220 (243)
138 cd00807 GlnRS_core catalytic c  34.4     6.9 0.00015   28.1  -1.4   18   43-60      7-24  (238)
139 cd06201 SiR_like2 Cytochrome p  34.3      21 0.00045   25.2   1.0   10   37-46    246-255 (289)
140 PRK01406 gltX glutamyl-tRNA sy  34.2     2.5 5.4E-05   32.7  -4.0   17   44-60     11-27  (476)
141 PF02675 AdoMet_dc:  S-adenosyl  34.1      27 0.00059   21.4   1.4    9   36-44     71-79  (106)
142 cd06184 flavohem_like_fad_nad_  34.1      27 0.00059   23.4   1.5   12   35-46    208-219 (247)
143 cd05829 Sortase_E Sortase E (S  33.2      96  0.0021   19.9   3.9   32   29-61    110-141 (144)
144 cd06183 cyt_b5_reduct_like Cyt  32.4      31 0.00066   22.7   1.5   13   35-47    200-212 (234)
145 cd06214 PA_degradation_oxidore  32.3      29 0.00063   23.0   1.4   11   36-46    206-216 (241)
146 PF01921 tRNA-synt_1f:  tRNA sy  31.9     1.7 3.7E-05   33.0  -5.1   30   36-65     23-52  (360)
147 PRK05713 hypothetical protein;  31.7      28 0.00061   24.7   1.3   13   35-47    273-285 (312)
148 cd06207 CyPoR_like NADPH cytoc  31.4      28  0.0006   25.6   1.3   12   35-46    328-339 (382)
149 cd02156 nt_trans nucleotidyl t  31.0      17 0.00036   21.8   0.0   13   43-56      5-17  (105)
150 PLN02627 glutamyl-tRNA synthet  30.8     3.1 6.8E-05   33.1  -4.0   17   44-60     52-68  (535)
151 cd06199 SiR Cytochrome p450- l  30.5      27 0.00058   25.6   1.1    9   37-45    308-316 (360)
152 TIGR00125 cyt_tran_rel cytidyl  30.4      15 0.00033   19.7  -0.2   12   45-56      6-17  (66)
153 KOG0436 Methionyl-tRNA synthet  30.3     3.3 7.1E-05   33.1  -3.9   21   46-66     50-70  (578)
154 PLN02859 glutamine-tRNA ligase  30.1     9.9 0.00021   31.7  -1.3   20   41-60    268-287 (788)
155 PRK05464 Na(+)-translocating N  29.7      35 0.00075   25.3   1.6   12   35-46    372-383 (409)
156 PRK06222 ferredoxin-NADP(+) re  29.4      28 0.00061   24.4   1.0   10   38-47    183-192 (281)
157 PRK13289 bifunctional nitric o  29.2      30 0.00065   25.1   1.1   11   36-46    358-368 (399)
158 KOG3378 Globins and related he  29.1     4.7  0.0001   30.7  -3.1   27   28-54    338-364 (385)
159 PHA02451 hypothetical protein   29.1      22 0.00047   20.5   0.3   10   39-48     20-29  (54)
160 PTZ00274 cytochrome b5 reducta  28.8      31 0.00067   25.3   1.1   11   37-47    264-274 (325)
161 TIGR01941 nqrF NADH:ubiquinone  28.6      37  0.0008   25.1   1.5   11   36-46    369-379 (405)
162 PRK10684 HCP oxidoreductase, N  28.1      33 0.00071   24.5   1.1   11   37-47    204-214 (332)
163 cd06206 bifunctional_CYPOR The  28.1      31 0.00067   25.4   1.1   11   36-46    328-338 (384)
164 cd06204 CYPOR NADPH cytochrome  28.1      33 0.00072   25.7   1.2   10   37-46    364-373 (416)
165 cd06203 methionine_synthase_re  27.9      35 0.00075   25.4   1.3   10   36-45    345-354 (398)
166 TIGR02160 PA_CoA_Oxy5 phenylac  27.9      33 0.00072   24.5   1.1   11   37-47    208-218 (352)
167 cd06219 DHOD_e_trans_like1 FAD  27.9      34 0.00073   23.4   1.2   10   38-47    182-191 (248)
168 TIGR03784 marine_sortase sorta  27.7 1.3E+02  0.0028   20.3   4.0   29   30-60    144-172 (174)
169 PLN03115 ferredoxin--NADP(+) r  27.7      38 0.00083   25.4   1.5   11   35-45    318-328 (367)
170 COG1586 SpeD S-adenosylmethion  27.2      31 0.00067   23.2   0.8   10   36-45     87-96  (136)
171 PRK00054 dihydroorotate dehydr  27.1      35 0.00077   23.2   1.1    9   38-46    183-191 (250)
172 cd00004 Sortase Sortases are c  26.6 1.4E+02  0.0031   18.2   3.8   16   30-45    100-115 (128)
173 cd06218 DHOD_e_trans FAD/NAD b  26.5      37 0.00081   23.2   1.2   11   36-46    180-190 (246)
174 cd06221 sulfite_reductase_like  26.2      35 0.00076   23.4   1.0   11   36-46    190-200 (253)
175 cd06220 DHOD_e_trans_like2 FAD  26.1      38 0.00083   22.8   1.2   10   37-46    168-177 (233)
176 PRK08345 cytochrome-c3 hydroge  25.8      42 0.00091   23.6   1.4   12   36-47    212-223 (289)
177 KOG0433 Isoleucyl-tRNA synthet  25.7     4.3 9.3E-05   34.3  -4.1   21   46-66     66-86  (937)
178 PRK07609 CDP-6-deoxy-delta-3,4  25.5      39 0.00085   24.0   1.2   11   36-46    298-308 (339)
179 PRK11872 antC anthranilate dio  25.4      39 0.00084   24.4   1.1   10   37-46    302-311 (340)
180 cd06192 DHOD_e_trans_like FAD/  25.1      41 0.00089   22.6   1.2   10   37-46    179-188 (243)
181 PF06364 DUF1068:  Protein of u  25.1      19 0.00041   25.2  -0.5   13   37-49     19-31  (176)
182 cd06193 siderophore_interactin  24.9      47   0.001   22.4   1.4   12   35-46    197-208 (235)
183 cd08064 MPN_eIF3f Mpr1p, Pad1p  24.4      55  0.0012   23.1   1.7   14   34-47     76-89  (265)
184 cd05828 Sortase_D_4 Sortase D   23.7 1.8E+02   0.004   18.0   3.9   19   27-45     93-111 (127)
185 KOG0279 G protein beta subunit  23.6 1.1E+02  0.0025   23.1   3.3   27    3-30    117-143 (315)
186 PLN02406 ethanolamine-phosphat  23.4      35 0.00076   26.5   0.6   23   33-57    248-270 (418)
187 COG1018 Hmp Flavodoxin reducta  23.1      43 0.00093   23.9   1.0   11   37-47    197-207 (266)
188 PRK08221 anaerobic sulfite red  21.9      62  0.0014   22.4   1.6   13   35-47    191-203 (263)
189 PF01234 NNMT_PNMT_TEMT:  NNMT/  21.8      60  0.0013   23.4   1.5   25   40-64     63-88  (256)
190 PF07865 DUF1652:  Protein of u  21.8 1.2E+02  0.0027   17.8   2.7   23    8-30     21-43  (69)
191 TIGR03224 benzo_boxA benzoyl-C  21.1      53  0.0011   24.7   1.2   10   37-46    364-373 (411)
192 KOG1147 Glutamyl-tRNA syntheta  21.1      20 0.00044   29.5  -1.1   16   43-58    206-221 (712)
193 TIGR03094 sulfo_cyanin sulfocy  20.7      77  0.0017   22.5   1.8   30   26-63    153-182 (195)
194 PF10477 EIF4E-T:  Nucleocytopl  20.5      39 0.00084   27.0   0.3   12   35-46    200-211 (578)
195 COG4198 Uncharacterized conser  20.5      55  0.0012   25.5   1.1   22   25-47    278-299 (405)
196 PRK06214 sulfite reductase; Pr  20.3      56  0.0012   25.8   1.2   10   36-45    477-486 (530)
197 PF01467 CTP_transf_2:  Cytidyl  20.2      24 0.00052   21.2  -0.7   11   46-56      5-15  (157)

No 1  
>KOG2007 consensus Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=99.95  E-value=1.6e-29  Score=194.54  Aligned_cols=63  Identities=46%  Similarity=0.716  Sum_probs=60.4

Q ss_pred             cccccc-cCCCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777            4 SKETTA-AAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus         4 ~~~~~~-~~~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+|..| +|.+++|+||||+||+||+|.|.++++|+||+|||||||.+||||||+||.||||+|
T Consensus        22 ~~w~~p~~~~~~~L~lYNslTr~Ke~fip~~~~~v~wY~CGpTvYD~SHmGHArsYVsfDIlrR   85 (586)
T KOG2007|consen   22 PHWDQPNAGQPTELKLYNSLTRQKEVFIPNNGNKVTWYICGPTVYDSSHMGHARSYVSFDILRR   85 (586)
T ss_pred             cccCCCCCCCCCeEEEeeccccccceeeeCCCCeEEEEEecCcccchhhhhhhhhhhhHHHHHH
Confidence            578888 888899999999999999999999999999999999999999999999999999997


No 2  
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=99.94  E-value=2.1e-28  Score=185.99  Aligned_cols=52  Identities=56%  Similarity=0.961  Sum_probs=50.6

Q ss_pred             ceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           15 DLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        15 ~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|+||||+||+||+|.|.++++|+||+|||||||++||||||+||+||+|+|
T Consensus         1 ~l~iyNTltr~ke~F~P~~~~~V~mYvCGpTVYd~~HIGhaRt~V~fDvl~R   52 (464)
T COG0215           1 MLKLYNTLTRQKEEFVPIDPGKVKMYVCGPTVYDYAHIGHARTYVVFDVLRR   52 (464)
T ss_pred             CcEEEecCccceecccCCCCCeEEEEecCCccCCccccccCcceehHHHHHH
Confidence            4899999999999999999999999999999999999999999999999987


No 3  
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional
Probab=99.93  E-value=1e-27  Score=186.70  Aligned_cols=62  Identities=37%  Similarity=0.515  Sum_probs=57.2

Q ss_pred             ccccccC---CCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777            5 KETTAAA---PKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus         5 ~~~~~~~---~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|..|..   ..++|+|||||||+||+|.|.+++.|+||+|||||||.+||||||+||+||+|+|
T Consensus        26 ~w~~p~~~~~~~~~l~lyNtlt~~k~~f~p~~~~~v~~Y~CGPTvYd~~HiGhart~v~~Dil~R   90 (651)
T PTZ00399         26 EWKKPSKEGKYLTGLKVNNSLTGGKVEFVPQNGRQVRWYTCGPTVYDSSHLGHARTYVTFDIIRR   90 (651)
T ss_pred             CCCCCCccCCCCCceEEEECCCCCccccccCCCCeeEEEEeCCCccCCcccccchHHHHHHHHHH
Confidence            5777764   2378999999999999999999999999999999999999999999999999987


No 4  
>PLN02946 cysteine-tRNA ligase
Probab=99.93  E-value=3.4e-27  Score=182.02  Aligned_cols=59  Identities=59%  Similarity=1.053  Sum_probs=56.0

Q ss_pred             cccCCCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777            8 TAAAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus         8 ~~~~~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|.+..|+|+||||+||+||+|.|.++++|+||+|||||||.+||||+|+||+||+|+|
T Consensus        52 ~~~~~~~~l~lyNTltr~ke~f~P~~~~~v~~Y~CGpTvYd~~HIGhaR~~V~~Dvl~R  110 (557)
T PLN02946         52 APASRGRELHLYNTMSRKKELFKPKVEGKVGMYVCGVTAYDLSHIGHARVYVTFDVLYR  110 (557)
T ss_pred             CcCCCCCceEEEECCCCCeeccccCCCCceeEEEeCCccCCCCccccchhhHHHHHHHH
Confidence            45667789999999999999999999999999999999999999999999999999987


No 5  
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional
Probab=99.92  E-value=7.2e-27  Score=177.89  Aligned_cols=53  Identities=38%  Similarity=0.673  Sum_probs=51.3

Q ss_pred             cceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        14 ~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |+|+||||+||+||+|.|+++++|+||+|||||||++||||+|+||+||+|+|
T Consensus         1 m~l~lyntlt~~ke~f~p~~~~~v~mYvCGpTvy~~~HiGhar~~v~~Dvl~R   53 (490)
T PRK14536          1 MALRLYNTLGRQQEEFQPIEHGHVRLYGCGPTVYNYAHIGNLRTYVFQDTLRR   53 (490)
T ss_pred             CceEEEecCCCCeeccccCCCCceEEEeeCCccCCCcccchhHHHHHHHHHHH
Confidence            46999999999999999999999999999999999999999999999999987


No 6  
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional
Probab=99.91  E-value=8.9e-26  Score=177.70  Aligned_cols=53  Identities=51%  Similarity=0.872  Sum_probs=51.5

Q ss_pred             cceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        14 ~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      ++|+||||+||++|+|.|++++.|+||+|||||||++||||||+||+||+|+|
T Consensus       226 ~~l~lyNTltr~ke~f~P~~~~~V~mYvCGPTVYd~~HIGHaRt~V~~DVL~R  278 (699)
T PRK14535        226 PMTTIYNTLTRQKEPFAPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIAR  278 (699)
T ss_pred             CceEEEECCCCCeeccccCCCCceEEEecCCcCCCCCcccchhHHHHHHHHHH
Confidence            56999999999999999999999999999999999999999999999999987


No 7  
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional
Probab=99.91  E-value=1e-25  Score=171.53  Aligned_cols=51  Identities=31%  Similarity=0.523  Sum_probs=48.8

Q ss_pred             cceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        14 ~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |+|+||||+||++|+|+|.  ++|+||+|||||||++||||+|+||+||+|+|
T Consensus         1 ~~l~lynTltr~ke~f~p~--~~v~mY~CGpTVYd~~HiGh~r~~v~~Dvl~R   51 (481)
T PRK14534          1 MLLKLYNTKTKDLSELKNF--SDVKVYACGPTVYNYAHIGNFRTYIFEDLLIK   51 (481)
T ss_pred             CceEEEEcCCCCeeecccC--CceEEEeCCCCCCCCCCccchhHHHHHHHHHH
Confidence            5799999999999999995  79999999999999999999999999999987


No 8  
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase. Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione.
Probab=99.90  E-value=3e-25  Score=166.43  Aligned_cols=56  Identities=32%  Similarity=0.625  Sum_probs=53.1

Q ss_pred             ccCCCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777            9 AAAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus         9 ~~~~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +++.+++|+||||+||+||+|+|  +++|+||+||||||+.+||||+|+||++|+|+|
T Consensus        11 ~~~~~~~l~lyntlt~~~~~f~p--~~~v~~YvCGpTvY~~~HIGhart~V~~Dvl~R   66 (411)
T TIGR03447        11 LPGTGPPLRLFDTADGQVRPVEP--GPEAGMYVCGITPYDATHLGHAATYLTFDLVNR   66 (411)
T ss_pred             CCCCCCceEEEECCCCCeeeccC--CCcceEEEeCCccCCCcccccchHHHHHHHHHH
Confidence            45677899999999999999999  789999999999999999999999999999987


No 9  
>TIGR00435 cysS cysteinyl-tRNA synthetase. This model finds the cysteinyl-tRNA synthetase from most but not from all species. The enzyme from one archaeal species, Archaeoglobus fulgidus, is found but the equivalent enzymes from some other Archaea, including Methanococcus jannaschii, are not found, although biochemical evidence suggests that tRNA(Cys) in these species are charged directly with Cys rather than through a misacylation and correction pathway as for tRNA(Gln).
Probab=99.87  E-value=6.2e-24  Score=159.72  Aligned_cols=51  Identities=59%  Similarity=1.010  Sum_probs=49.8

Q ss_pred             eEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        16 l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |+||||+||+||+|.|.++++|+||+||||||+++||||+|+||++|+++|
T Consensus         1 l~lyntlt~~~e~f~p~~~~~v~~yvcgptvy~~~HiGhar~~v~~Dvl~R   51 (465)
T TIGR00435         1 LKLYNTLTRQKEEFEPLVQGKVKMYVCGPTVYDYCHIGHARTAIVFDVLRR   51 (465)
T ss_pred             CeeEeCCCCCeeccccCCCCcceEEEecCccCCCcccccchHHHHHHHHHH
Confidence            689999999999999999999999999999999999999999999999987


No 10 
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated
Probab=99.87  E-value=1.3e-23  Score=157.49  Aligned_cols=53  Identities=57%  Similarity=0.979  Sum_probs=51.4

Q ss_pred             cceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        14 ~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |.|+||||+||++|+|.|.+++.++||+||||||+.+||||+|+||.+|+|+|
T Consensus         1 ~~l~~~ntl~~~~~~f~p~~~~~v~~yvcgPtvy~~~HiGHar~~v~~Dvl~R   53 (463)
T PRK00260          1 MMLKIYNTLTRQKEEFKPLEPGKVKMYVCGPTVYDYAHIGHARSFVVFDVLRR   53 (463)
T ss_pred             CceEEEECCCCceeecccCCCCcceEEEeCCccCCCcccccchhHHHHHHHHH
Confidence            57999999999999999999999999999999999999999999999999987


No 11 
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase. Cysteinyl tRNA synthetase (CysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=99.83  E-value=3.4e-22  Score=138.15  Aligned_cols=50  Identities=52%  Similarity=0.952  Sum_probs=48.5

Q ss_pred             EEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           17 IIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        17 ~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +||||+||++++|+|..++++++|+||||||+.+||||+|+||.+|+++|
T Consensus         1 ~~~~t~~~~~~~~~p~~~~~~~~y~~gpt~y~~~HiGH~r~~v~~Dvl~R   50 (213)
T cd00672           1 RLYNTLTRQKEEFVPLNPGLVTMYVCGPTVYDYAHIGHARTYVVFDVLRR   50 (213)
T ss_pred             CcccCCCCceeeeecCCCCCceEEEeCCccCCCcccccchhHHHHHHHHH
Confidence            58999999999999999999999999999999999999999999999987


No 12 
>PF01406 tRNA-synt_1e:  tRNA synthetases class I (C) catalytic domain;  InterPro: IPR015803 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Cysteinyl-tRNA synthetase (6.1.1.16 from EC) is an alpha monomer and belongs to class Ia.; GO: 0000166 nucleotide binding, 0004817 cysteine-tRNA ligase activity, 0005524 ATP binding, 0006423 cysteinyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 3SP1_B 3TQO_A 3C8Z_B 1LI5_B 1LI7_B 1U0B_B.
Probab=99.77  E-value=4.5e-21  Score=139.72  Aligned_cols=38  Identities=55%  Similarity=1.048  Sum_probs=32.4

Q ss_pred             eeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           29 FTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        29 f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |+|+++++|+||+|||||||++||||||+||+||+|+|
T Consensus         1 F~p~~~~~v~~Y~CGPTVYd~~HiGhaR~~v~~D~l~R   38 (300)
T PF01406_consen    1 FKPLNPGKVRMYVCGPTVYDYAHIGHARTYVFFDVLRR   38 (300)
T ss_dssp             ---SCTTEEEEEEEEEBTTS--BHHHHHHHHHHHHHHH
T ss_pred             CcCCCCCeEEEEcCCCCCCCCCCCcceeeeeeHHHHHH
Confidence            78999999999999999999999999999999999987


No 13 
>PRK12418 cysteinyl-tRNA synthetase; Provisional
Probab=99.63  E-value=2e-17  Score=123.28  Aligned_cols=37  Identities=46%  Similarity=0.991  Sum_probs=34.8

Q ss_pred             eecCCC-eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           30 TPIVPG-KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        30 ~p~~~~-~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|+.|| +|+||+||||||+++||||+|+||+||+|+|
T Consensus         2 ~p~~~~~~v~~YvCGpTvY~~~HIGh~r~~V~~Dvl~R   39 (384)
T PRK12418          2 RPVAPGGTATMYVCGITPYDATHLGHAATYLAFDLVNR   39 (384)
T ss_pred             cCCCCCCeeEEEecCCCCCCCCccchhHHHHHHHHHHH
Confidence            467778 9999999999999999999999999999987


No 14 
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase. Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=98.38  E-value=1.3e-08  Score=65.09  Aligned_cols=28  Identities=29%  Similarity=0.516  Sum_probs=26.4

Q ss_pred             eEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           39 MYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        39 ~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +|.|||++.+..||||+|+++..|+++|
T Consensus         1 ~~~~~p~~~~~~HlGh~~~~~~~d~~~r   28 (143)
T cd00802           1 TTFSGITPNGYLHIGHLRTIVTFDFLAQ   28 (143)
T ss_pred             CEecCCCCCCCccHhHHHHHHHHHHHHH
Confidence            5899999999999999999999999876


No 15 
>PRK01611 argS arginyl-tRNA synthetase; Reviewed
Probab=98.23  E-value=1.3e-07  Score=71.87  Aligned_cols=34  Identities=24%  Similarity=0.132  Sum_probs=31.7

Q ss_pred             CCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           33 VPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        33 ~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+++|.+|.|||+++...||||+|+++..|+|.|
T Consensus       109 ~~~~v~Ie~~spnp~g~lHiGH~R~~iigD~laR  142 (507)
T PRK01611        109 KGKKVVVEYVSANPTGPLHVGHLRSAVIGDALAR  142 (507)
T ss_pred             CCCEEEEEecCCCCCCCCcCCchHHHHHHHHHHH
Confidence            4578999999999999999999999999999876


No 16 
>PRK11893 methionyl-tRNA synthetase; Reviewed
Probab=98.09  E-value=2.4e-07  Score=69.09  Aligned_cols=30  Identities=17%  Similarity=0.114  Sum_probs=27.7

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-+.+++|||++.+||||+|+||.+|+++|
T Consensus         3 ~~i~~~~P~~~g~~HiGh~~~~~~~Dv~~R   32 (511)
T PRK11893          3 FYITTPIYYPNGKPHIGHAYTTLAADVLAR   32 (511)
T ss_pred             EEEecCCCCCCCCcccchhHHHHHHHHHHH
Confidence            457789999999999999999999999987


No 17 
>TIGR00456 argS arginyl-tRNA synthetase. This model recognizes arginyl-tRNA synthetase in every completed genome to date. An interesting feature of the alignment of all arginyl-tRNA synthetases is a fairly deep split between two families. One family includes archaeal, eukaryotic and organellar, spirochete, E. coli, and Synechocystis sp. The second, sharing a deletion of about 25 residues in the central region relative to the first, includes Bacillus subtilis, Aquifex aeolicus, the Mycoplasmas and Mycobacteria, and the Gram-negative bacterium Helicobacter pylori.
Probab=98.05  E-value=2.7e-07  Score=71.12  Aligned_cols=42  Identities=26%  Similarity=0.174  Sum_probs=34.4

Q ss_pred             ceEEeeecC--CCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           25 QKELFTPIV--PGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        25 ~ke~f~p~~--~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.+.|-+..  +.+|.++.|+|+++.+.||||+|+++..|+|+|
T Consensus       100 ~~~~~g~~~~~~~~v~ve~~spn~~~~~hiGh~r~~~~gd~l~r  143 (566)
T TIGR00456       100 QKEDYGSKKLKNKKIIIEFSSANPAGPLHIGHLRNAIIGDSLAR  143 (566)
T ss_pred             cccccCCCCCCCCeEEEEecCCCCCCCCchhhhHHHHHHHHHHH
Confidence            344554333  348999999999999999999999999999876


No 18 
>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases. Arginyl tRNA synthetase (ArgRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. There are at least three subgroups of ArgRS. One type contains both characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The second subtype lacks the KMSKS motif; however, it has a lysine N-terminal to the HIGH motif, which serves as the functional counterpart to the second lysine of the KMSKS motif. A third group, which is found  primarily in archaea and a few bacteria,  lacks both the KMSKS motif and the HIGH loop lysine.
Probab=97.76  E-value=1.6e-06  Score=59.20  Aligned_cols=26  Identities=27%  Similarity=0.197  Sum_probs=24.3

Q ss_pred             EeCCccCCCCCCCccceEEEEEeeeC
Q 036777           41 VCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .++|++.+.+||||+|++|.+|+|+|
T Consensus         6 ~~spN~~~~~HiGH~R~~vigD~l~R   31 (212)
T cd00671           6 FVSANPTGPLHVGHLRNAIIGDSLAR   31 (212)
T ss_pred             ecCCCCCCCccccccHHHHHHHHHHH
Confidence            57899999999999999999999986


No 19 
>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase. Non-discriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain. These enzymes attach Glu to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme.
Probab=97.58  E-value=2.5e-06  Score=60.82  Aligned_cols=26  Identities=35%  Similarity=0.201  Sum_probs=23.9

Q ss_pred             EeCCccCCCCCCCccceEEEEEeeeC
Q 036777           41 VCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -||||++.+.||||+|+++++++++|
T Consensus         5 RfaPsPtG~lHiG~~rtal~~~l~Ar   30 (240)
T cd09287           5 RFAPNPNGPLHLGHARAAILNGEYAK   30 (240)
T ss_pred             eCCCCCCCCccHHHHHHHHHHHHHHH
Confidence            59999999999999999999988765


No 20 
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. Catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. These class I enzymes are all monomers. However, in some species, MetRS functions as a homodimer, as a result of an additional C-terminal domain. These enzymes aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  Enzymes in this subfamily share an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. MetRS has a significantly shorter insertion, which lacks the editing function.
Probab=97.55  E-value=3.9e-06  Score=59.72  Aligned_cols=29  Identities=24%  Similarity=0.063  Sum_probs=25.8

Q ss_pred             eeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+..-.|||++.+||||+|+++.+|+++|
T Consensus         3 ~i~~~pP~~~g~~HiGH~~~~i~~D~i~R   31 (312)
T cd00668           3 YVTTPPPYANGSLHLGHALTHIIADFIAR   31 (312)
T ss_pred             EEecCCCCCCCCcchhHHHHHHHHHHHHH
Confidence            35567899999999999999999999986


No 21 
>PRK12268 methionyl-tRNA synthetase; Reviewed
Probab=97.53  E-value=1.2e-05  Score=61.06  Aligned_cols=28  Identities=18%  Similarity=0.282  Sum_probs=23.3

Q ss_pred             eEEeCC--ccCCCCCCCccceE-EEEEeeeC
Q 036777           39 MYVCGV--TAYDLSHLGHARAA-ISFYILYS   66 (66)
Q Consensus        39 ~Y~CGP--TvYd~~HiGhaR~~-V~~Dvl~R   66 (66)
                      +|+|.|  +|++.+||||++++ |.+|+++|
T Consensus         5 ~~i~~~~py~ng~~HiGH~~~~~~~~D~~~R   35 (556)
T PRK12268          5 ILITSAWPYANGPLHLGHLAGSGLPADVFAR   35 (556)
T ss_pred             EEEecCCCCCCCCccccccccchhHHHHHHH
Confidence            566665  45599999999998 99999987


No 22 
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases. Isoleucine amino-acyl tRNA synthetases (IleRS) catalytic core domain . This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=97.50  E-value=4.5e-06  Score=60.65  Aligned_cols=27  Identities=30%  Similarity=0.153  Sum_probs=24.0

Q ss_pred             EEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           40 YVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        40 Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -.--|||++.+||||+|+++.+|+++|
T Consensus         6 ~~~pP~vnG~lHiGHa~~~~~~Dvl~R   32 (338)
T cd00818           6 HDGPPYANGLPHYGHALNKILKDIINR   32 (338)
T ss_pred             ecCCCCCCCCchHHHHHHHHHHHHHHH
Confidence            344689999999999999999999987


No 23 
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases. Methionine tRNA synthetase (MetRS) catalytic core domain. This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and an anti-codon binding domain, functions as a monomer. However, in some species the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  As a result of a deletion event, MetRS has a significantly shorter core domain insertion than IleRS, ValRS, and LeuR.  Consequently, the MetRS insertion lacks the editing function.
Probab=97.45  E-value=9.5e-06  Score=58.20  Aligned_cols=27  Identities=15%  Similarity=0.135  Sum_probs=24.1

Q ss_pred             EEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           40 YVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        40 Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      =+..|+|++.+||||+|+++.+|+++|
T Consensus         5 t~~~Py~ng~~HlGH~~~~~~~Dv~~R   31 (319)
T cd00814           5 TTALPYVNGVPHLGHLYGTVLADVFAR   31 (319)
T ss_pred             EeCCCCCCCCcchhhHHHHHHHHHHHH
Confidence            356788899999999999999999987


No 24 
>TIGR00398 metG methionyl-tRNA synthetase. The methionyl-tRNA synthetase (metG) is a class I amino acyl-tRNA ligase. This model appears to recognize the methionyl-tRNA synthetase of every species, including eukaryotic cytosolic and mitochondrial forms. The UPGMA difference tree calculated after search and alignment according to this model shows an unusual deep split between two families of MetG. One family contains forms from the Archaea, yeast cytosol, spirochetes, and E. coli, among others. The other family includes forms from yeast mitochondrion, Synechocystis sp., Bacillus subtilis, the Mycoplasmas, Aquifex aeolicus, and Helicobacter pylori. The E. coli enzyme is homodimeric, although monomeric forms can be prepared that are fully active. Activity of this enzyme in bacteria includes aminoacylation of fMet-tRNA with Met; subsequent formylation of the Met to fMet is catalyzed by a separate enzyme. Note that the protein from Aquifex aeolicus is split into an alpha (large) and beta (sma
Probab=97.41  E-value=1e-05  Score=61.20  Aligned_cols=27  Identities=26%  Similarity=0.148  Sum_probs=24.8

Q ss_pred             EEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           40 YVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        40 Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      =+..|++.+.+||||+|+||.+|+|+|
T Consensus         4 t~~~P~~ng~lHiGH~~~~~~aDvl~R   30 (530)
T TIGR00398         4 TTALPYANGKPHLGHAYTTILADVYAR   30 (530)
T ss_pred             ecCCCCCCCCcccchhHHHHHHHHHHH
Confidence            357899999999999999999999987


No 25 
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional
Probab=97.22  E-value=2.6e-05  Score=61.32  Aligned_cols=32  Identities=41%  Similarity=0.314  Sum_probs=28.1

Q ss_pred             CCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           34 PGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        34 ~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +|+|.++ |+|+++.+.||||||++++.+.++|
T Consensus        99 ~g~V~tR-FaPsPtG~LHIGharaalln~~~Ar  130 (567)
T PRK04156         99 KGKVVMR-FAPNPSGPLHLGHARAAILNDEYAK  130 (567)
T ss_pred             CCeEEEE-eCCCCCCCccHHHHHHHHHHHHHHH
Confidence            5679998 9999999999999999988776654


No 26 
>PRK12267 methionyl-tRNA synthetase; Reviewed
Probab=97.06  E-value=5.8e-05  Score=58.85  Aligned_cols=29  Identities=28%  Similarity=0.408  Sum_probs=25.4

Q ss_pred             eeEEeCCccC--CCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAY--DLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvY--d~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+|++-|-.|  +.+||||+|+|+.+|+++|
T Consensus         5 ~~~it~~~py~ng~~HiGH~~~~~~aDv~~R   35 (648)
T PRK12267          5 TFYITTPIYYPNGKPHIGHAYTTIAADALAR   35 (648)
T ss_pred             CEEEeeCCCCCCCCcccccchHHHHHHHHHH
Confidence            4677777777  9999999999999999987


No 27 
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=96.85  E-value=7.5e-05  Score=58.68  Aligned_cols=23  Identities=30%  Similarity=0.170  Sum_probs=21.6

Q ss_pred             CccCCCCCCCccceEEEEEeeeC
Q 036777           44 VTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |++.+.+||||+|+|+.+|+++|
T Consensus        11 py~ng~~HiGH~~~~l~aDv~aR   33 (673)
T PRK00133         11 PYANGPIHLGHLVEYIQADIWVR   33 (673)
T ss_pred             CCCCCcccccchHHHHHHHHHHH
Confidence            48999999999999999999987


No 28 
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases. Leucyl tRNA synthetase (LeuRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=96.83  E-value=7.9e-05  Score=53.53  Aligned_cols=26  Identities=23%  Similarity=0.084  Sum_probs=23.1

Q ss_pred             EeCCccCCCCCCCccceEEEEEeeeC
Q 036777           41 VCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +-=|++.+.+||||+|++|..|+++|
T Consensus         6 ~~~Py~ng~~HiGH~~~~v~~Dv~~R   31 (314)
T cd00812           6 VMFPYPSGALHVGHVRTYTIGDIIAR   31 (314)
T ss_pred             cCCCCCCCCccccchHHHHHHHHHHH
Confidence            34589999999999999999999987


No 29 
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=96.82  E-value=0.00012  Score=54.58  Aligned_cols=29  Identities=17%  Similarity=0.282  Sum_probs=25.9

Q ss_pred             eeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+..+|++++..+||||+|.++..|+++|
T Consensus        21 ~~v~tgi~psG~~HIG~~~e~i~~D~i~R   49 (353)
T cd00674          21 YVVASGISPSGHIHIGNFREVITADLVAR   49 (353)
T ss_pred             EEEecCCCCCCCcccCccHHHHHHHHHHH
Confidence            34567999999999999999999999876


No 30 
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases. Valine amino-acyl tRNA synthetase (ValRS) catalytic core domain. This enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=96.77  E-value=5.8e-05  Score=55.70  Aligned_cols=27  Identities=19%  Similarity=0.038  Sum_probs=24.0

Q ss_pred             EEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           40 YVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        40 Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+--|+|.+.+||||+++++..|+++|
T Consensus         6 ~~~pPy~nG~lHiGH~~~~~~~Dv~~R   32 (382)
T cd00817           6 DTPPPNVTGSLHMGHALNNTIQDIIAR   32 (382)
T ss_pred             ecCCCCCCCcchHHHHHHHHHHHHHHH
Confidence            344589999999999999999999987


No 31 
>PLN02224 methionine-tRNA ligase
Probab=96.24  E-value=0.00078  Score=53.25  Aligned_cols=45  Identities=11%  Similarity=0.096  Sum_probs=31.0

Q ss_pred             CCCceEEeeecC--CCe-----eeeEEeC-CccCCCCCCCccceEEEEEeeeC
Q 036777           22 MTQQKELFTPIV--PGK-----VGMYVCG-VTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        22 ltr~ke~f~p~~--~~~-----v~~Y~CG-PTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+++++.|.|..  +++     .-+-+++ |+|-+.+||||+++++..|++.|
T Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~~~ittp~pY~NG~~HiGHa~~~~~aDviaR  100 (616)
T PLN02224         48 SSGKRALYCTSSSQESTVDEADTFVLTTPLYYVNAPPHMGSAYTTIAADSIAR  100 (616)
T ss_pred             ccccceeeccCCCcccCCCCCCeEEEeCCCCCCCCCCchhccHHHHHHHHHHH
Confidence            445666776632  122     2233344 48889999999999999999987


No 32 
>PRK00390 leuS leucyl-tRNA synthetase; Validated
Probab=96.16  E-value=0.00055  Score=55.11  Aligned_cols=29  Identities=24%  Similarity=0.305  Sum_probs=26.1

Q ss_pred             eeEEeCCccC--CCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAY--DLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvY--d~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.|+|.+.+|  ...||||+++|+..|++.|
T Consensus        33 ~~~i~~~pPy~nG~lHiGH~~~~~~~Dii~R   63 (805)
T PRK00390         33 KYYVLDMFPYPSGGLHMGHVRNYTIGDVIAR   63 (805)
T ss_pred             CEEEEccCCCCCCCcchhhhHHHHHHHHHHH
Confidence            6888887777  9999999999999999987


No 33 
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=96.07  E-value=0.0012  Score=50.91  Aligned_cols=29  Identities=17%  Similarity=0.251  Sum_probs=27.0

Q ss_pred             eeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+..||+++...+||||+|.++..|+++|
T Consensus        25 ~~~~~g~~psG~~HiG~~~e~~~~d~v~r   53 (510)
T PRK00750         25 VVVETGIGPSGLPHIGNFREVARTDMVRR   53 (510)
T ss_pred             EEEEeCCCCCCCcccccccchhhHHHHHH
Confidence            67899999999999999999999999876


No 34 
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family. The leucyl-tRNA synthetases belong to two families so broadly different that they are represented by separate models. This model includes both eubacterial and mitochondrial leucyl-tRNA synthetases. It generates higher scores for some valyl-tRNA synthetases than for any archaeal or eukaryotic cytosolic leucyl-tRNA synthetase. Note that the enzyme from Aquifex aeolicus is split into alpha and beta chains; neither chain is long enough to score above the trusted cutoff, but the alpha chain scores well above the noise cutoff. The beta chain must be found by a model and search designed for partial length matches.
Probab=95.62  E-value=0.0015  Score=53.07  Aligned_cols=32  Identities=25%  Similarity=0.372  Sum_probs=27.1

Q ss_pred             CeeeeEEeCCccC--CCCCCCccceEEEEEeeeC
Q 036777           35 GKVGMYVCGVTAY--DLSHLGHARAAISFYILYS   66 (66)
Q Consensus        35 ~~v~~Y~CGPTvY--d~~HiGhaR~~V~~Dvl~R   66 (66)
                      ++-+.|++.+.+|  ...||||+++|+..|++.|
T Consensus        27 ~k~k~~v~~~pPy~nG~lHiGH~~~~~~~Dvi~R   60 (842)
T TIGR00396        27 NKPKYYILDMFPYPSGALHMGHVRNYTITDVLSR   60 (842)
T ss_pred             CCCCEEEEcCCCCCCCccccchhHHHHHHHHHHH
Confidence            4556888876666  8999999999999999987


No 35 
>PRK13208 valS valyl-tRNA synthetase; Reviewed
Probab=94.35  E-value=0.0046  Score=49.53  Aligned_cols=31  Identities=13%  Similarity=0.005  Sum_probs=27.3

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.-+..-.|++....||||+++++..|++.|
T Consensus        39 ~f~i~~ppPy~nG~lHiGH~~~~~~~D~~~R   69 (800)
T PRK13208         39 VYSIDTPPPTVSGSLHIGHVFSYTHTDFIAR   69 (800)
T ss_pred             cEEEecCcCCCCCCccHHHHHhHHHHHHHHH
Confidence            4566677899999999999999999999876


No 36 
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=93.51  E-value=0.0065  Score=47.95  Aligned_cols=24  Identities=17%  Similarity=0.092  Sum_probs=22.0

Q ss_pred             CCccCCCCCCCccceEEEEEeeeC
Q 036777           43 GVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      =|.+-+.+||||+.++|..|+++|
T Consensus        13 lpY~Ng~~HlGH~~~~l~ADv~aR   36 (558)
T COG0143          13 LPYPNGPPHLGHLYTYLAADVYAR   36 (558)
T ss_pred             CCCCCCCcchhhHHHHHHHHHHHH
Confidence            468889999999999999999987


No 37 
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=92.48  E-value=0.0034  Score=46.84  Aligned_cols=24  Identities=21%  Similarity=0.084  Sum_probs=20.7

Q ss_pred             CCccCCCCCCCccceEEEEEeeeC
Q 036777           43 GVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -|++-..+||||+.+|+..|+++|
T Consensus         7 ~pY~Ng~lHlGH~~~~l~ADv~aR   30 (391)
T PF09334_consen    7 IPYPNGDLHLGHLYPYLAADVLAR   30 (391)
T ss_dssp             EEETSSS-BHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCChhHHHHHHHHHHH
Confidence            468889999999999999999876


No 38 
>PLN02610 probable methionyl-tRNA synthetase
Probab=90.30  E-value=0.028  Score=45.81  Aligned_cols=25  Identities=16%  Similarity=0.179  Sum_probs=20.9

Q ss_pred             eCCccCCCCCCCccc-eEEEEEeeeC
Q 036777           42 CGVTAYDLSHLGHAR-AAISFYILYS   66 (66)
Q Consensus        42 CGPTvYd~~HiGhaR-~~V~~Dvl~R   66 (66)
                      -=|++-+.+||||+. +|+..|++.|
T Consensus        24 ~~pY~Ng~~HlGH~~~~~l~aDv~aR   49 (801)
T PLN02610         24 ALPYVNNVPHLGNIIGCVLSADVFAR   49 (801)
T ss_pred             CCCCCCCCcccchhhhhHHHHHHHHH
Confidence            346788899999999 5788999887


No 39 
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family. The leucyl-tRNA synthetases belong to two families so broadly different that they are represented by separate models. This model includes both archaeal and cytosolic eukaryotic leucyl-tRNA synthetases; the eubacterial and mitochondrial forms differ so substantially that some other tRNA ligases score higher by this model than does any eubacterial LeuS.
Probab=89.76  E-value=0.039  Score=45.39  Aligned_cols=30  Identities=13%  Similarity=-0.012  Sum_probs=24.6

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-+..-=|.+-...||||+++++..|++.|
T Consensus        27 f~i~~ppPy~nG~lH~GH~~~~~~~D~~aR   56 (938)
T TIGR00395        27 FFLTMAYPYLNGVMHAGHCRTFTIPEVSAR   56 (938)
T ss_pred             eEEecCCCCCCCCcccchhhhhhHHHHHHH
Confidence            345555677779999999999999999876


No 40 
>PLN02563 aminoacyl-tRNA ligase
Probab=89.28  E-value=0.046  Score=45.49  Aligned_cols=32  Identities=25%  Similarity=0.198  Sum_probs=23.9

Q ss_pred             CeeeeEE-eC-CccCCC-CCCCccceEEEEEeeeC
Q 036777           35 GKVGMYV-CG-VTAYDL-SHLGHARAAISFYILYS   66 (66)
Q Consensus        35 ~~v~~Y~-CG-PTvYd~-~HiGhaR~~V~~Dvl~R   66 (66)
                      ++-+.|+ +| |.+-.. .||||+++|+.-|++.|
T Consensus       108 ~k~k~~v~~~~PYpnG~~lHiGH~~~y~~~DviaR  142 (963)
T PLN02563        108 SKPKFYVLDMFPYPSGAGLHVGHPEGYTATDILAR  142 (963)
T ss_pred             CCCCEEEEeCCCCCCCcccchhhHHHHHHHHHHHH
Confidence            3445554 34 666665 89999999999999876


No 41 
>TIGR00422 valS valyl-tRNA synthetase. The valyl-tRNA synthetase (ValS) is a class I amino acyl-tRNA ligase and is particularly closely related to the isoleucyl tRNA synthetase.
Probab=88.33  E-value=0.062  Score=43.49  Aligned_cols=31  Identities=16%  Similarity=0.019  Sum_probs=26.9

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +..++.--|++-...||||+++++..|++.|
T Consensus        34 ~f~i~~ppPy~nG~lHiGH~~~~~~~D~~~R   64 (861)
T TIGR00422        34 PFCIDIPPPNVTGSLHIGHALNWSIQDIIAR   64 (861)
T ss_pred             eEEEEeCCCCCCCCCcHHHhHHHHHHHHHHH
Confidence            4567777788889999999999999999876


No 42 
>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family. The glutamyl-tRNA synthetases of the eukaryotic cytosol and of the Archaea are more similar to glutaminyl-tRNA synthetases than to bacterial glutamyl-tRNA synthetases. This alignment models just the eukaryotic cytosolic and archaeal forms of the enzyme. In some eukaryotes, the glutamyl-tRNA synthetase is part of a longer, multifunctional aminoacyl-tRNA ligase. In many species, the charging of tRNA(gln) proceeds first through misacylation with Glu and then transamidation. For this reason, glutamyl-tRNA synthetases may act on both tRNA(gln) and tRNA(glu).
Probab=88.08  E-value=0.03  Score=44.33  Aligned_cols=25  Identities=32%  Similarity=0.268  Sum_probs=20.5

Q ss_pred             EeCCccCCCCCCCccceEEEEEeee
Q 036777           41 VCGVTAYDLSHLGHARAAISFYILY   65 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~Dvl~   65 (66)
                      -.-|++..+.||||||++++.+.++
T Consensus        97 RFaPsPtG~LHiGharaalln~~~A  121 (560)
T TIGR00463        97 RFAPNPSGPLHIGHARAAILNQYFA  121 (560)
T ss_pred             EeCCCCCCCccHHHHHHHHHHHHHH
Confidence            4579999999999999988766543


No 43 
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=87.75  E-value=0.097  Score=40.90  Aligned_cols=30  Identities=20%  Similarity=0.251  Sum_probs=26.4

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-+..+|.++-..+||||+|-.+..|+++|
T Consensus        19 ~~~~~tg~~psG~~HiG~~~e~~~~d~v~r   48 (515)
T TIGR00467        19 LYTVASGITPSGHIHIGNFREVITADAIAR   48 (515)
T ss_pred             eEEEecCCCCCCCccccchhhhhHHHHHHH
Confidence            356789999999999999999999988765


No 44 
>PLN02943 aminoacyl-tRNA ligase
Probab=86.85  E-value=0.054  Score=44.74  Aligned_cols=30  Identities=17%  Similarity=0.023  Sum_probs=26.1

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -.+...-|.|-...|||||++++.-|++.|
T Consensus        90 f~i~~pPP~~tG~lHiGHa~~~~~~D~~~R  119 (958)
T PLN02943         90 FVIPMPPPNVTGSLHMGHAMFVTLEDIMVR  119 (958)
T ss_pred             EEEecCCCCCCCchhHHHHHHHHHHHHHHH
Confidence            456666799999999999999999999876


No 45 
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional
Probab=86.40  E-value=0.095  Score=43.27  Aligned_cols=31  Identities=19%  Similarity=0.103  Sum_probs=26.7

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      ..-+...-|++-...||||+++++..|++.|
T Consensus        61 ~f~i~~ppP~~~G~lHiGHa~~~~~~D~~~R   91 (995)
T PTZ00419         61 KFVIVLPPPNVTGYLHIGHALTGAIQDSLIR   91 (995)
T ss_pred             eEEEEeCCCCCCCCCcHHHHHHHHHHHHHHH
Confidence            4566677788999999999999999999876


No 46 
>TIGR00392 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA synthetase (IleS) is a class I amino acyl-tRNA ligase and is particularly closely related to the valyl tRNA synthetase. This model may recognize IleS from every species, including eukaryotic cytosolic and mitochondrial forms.
Probab=86.39  E-value=0.045  Score=44.22  Aligned_cols=30  Identities=27%  Similarity=0.074  Sum_probs=24.0

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      --++.--|.+-...||||+++++.-|++.|
T Consensus        38 f~i~~~pPy~nG~lH~GH~~~~~~~D~~~R   67 (861)
T TIGR00392        38 FIFHDGPPYANGSIHLGHALNKILKDIILR   67 (861)
T ss_pred             eEEecCCCCCCCCccHHHHHHHHHHHHHHH
Confidence            344455567779999999999999999876


No 47 
>PLN02381 valyl-tRNA synthetase
Probab=86.39  E-value=0.088  Score=44.13  Aligned_cols=30  Identities=17%  Similarity=0.064  Sum_probs=26.2

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-+...-|.+-...||||+++++.-|++.|
T Consensus       130 f~i~~ppPy~nG~lHiGHa~~~ti~Dii~R  159 (1066)
T PLN02381        130 FVIVLPPPNVTGALHIGHALTAAIEDTIIR  159 (1066)
T ss_pred             EEEEeCCCCCCCCccHHHHHHHHHHHHHHH
Confidence            566777788889999999999999999876


No 48 
>PRK14900 valS valyl-tRNA synthetase; Provisional
Probab=85.71  E-value=0.092  Score=43.87  Aligned_cols=31  Identities=23%  Similarity=0.164  Sum_probs=27.1

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-.+...-|++-...||||+++++.-|++.|
T Consensus        49 ~f~i~~pPP~~nG~lHiGH~~~~~~~Di~~R   79 (1052)
T PRK14900         49 PFSIVLPPPNVTGSLHLGHALTATLQDVLIR   79 (1052)
T ss_pred             CEEEecCCCCCCCcchHHHHHhhHHHHHHHH
Confidence            3567777889999999999999999999876


No 49 
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=85.39  E-value=0.15  Score=42.19  Aligned_cols=29  Identities=24%  Similarity=0.312  Sum_probs=23.8

Q ss_pred             eeEEeCCccC--CCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAY--DLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvY--d~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.|+.=+=+|  ...|+||.|+|..-|++.|
T Consensus        35 Kfyvl~mfPYpSG~LHvGH~r~Yti~Dv~aR   65 (814)
T COG0495          35 KFYVLVMFPYPSGALHVGHVRNYTIGDVIAR   65 (814)
T ss_pred             ceEEEeCCCCCCCCcccCccccccHHHHHHH
Confidence            7777666666  4589999999999999876


No 50 
>PRK05729 valS valyl-tRNA synthetase; Reviewed
Probab=84.56  E-value=0.061  Score=43.73  Aligned_cols=30  Identities=20%  Similarity=0.148  Sum_probs=25.4

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      ..+...-|.|-...|||||.+++.-|++.|
T Consensus        38 f~i~~ppP~~~G~lHiGHa~~~~~~D~~~R   67 (874)
T PRK05729         38 FSIVIPPPNVTGSLHMGHALNNTLQDILIR   67 (874)
T ss_pred             EEEecCCCCCCCcchHHHHHHHHHHHHHHH
Confidence            455566788889999999999999999876


No 51 
>PLN02959 aminoacyl-tRNA ligase
Probab=84.19  E-value=0.11  Score=43.63  Aligned_cols=29  Identities=21%  Similarity=0.111  Sum_probs=23.5

Q ss_pred             eeEEeC--CccCCCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCG--VTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CG--PTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      ..++.+  |.+-...||||+++++.-|++.|
T Consensus        46 kf~i~~ppPY~NG~lHiGHa~t~t~~D~i~R   76 (1084)
T PLN02959         46 KFFGNFPYPYMNGLLHLGHAFSLSKLEFAAA   76 (1084)
T ss_pred             cEEEeCCCCCCCCCcchhhHHHHHHHHHHHH
Confidence            344444  77888999999999999999876


No 52 
>PLN02882 aminoacyl-tRNA ligase
Probab=83.51  E-value=0.1  Score=44.10  Aligned_cols=31  Identities=26%  Similarity=0.144  Sum_probs=27.4

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-.+|.--|++-..+|+||+++++.-|++.|
T Consensus        39 ~f~~~dgPPyanG~~HiGH~~~~~ikDii~R   69 (1159)
T PLN02882         39 EYIFYDGPPFATGLPHYGHILAGTIKDIVTR   69 (1159)
T ss_pred             CEEEeCCCCCCCCcchhhHHHHHHHHHHHHH
Confidence            3577888899999999999999999999876


No 53 
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed
Probab=83.25  E-value=0.095  Score=43.05  Aligned_cols=30  Identities=23%  Similarity=0.045  Sum_probs=24.4

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-+..--|.+-...|||||++++.-|++.|
T Consensus        51 f~i~~~pPyanG~lHiGHa~~~~~~Dii~R   80 (912)
T PRK05743         51 FILHDGPPYANGDIHIGHALNKILKDIIVK   80 (912)
T ss_pred             EEEeCCCCCCCCCccHHHHHHHHHHHHHHH
Confidence            344455677888999999999999999876


No 54 
>KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism]
Probab=82.10  E-value=0.37  Score=36.49  Aligned_cols=24  Identities=46%  Similarity=0.697  Sum_probs=20.3

Q ss_pred             CCCeeeeEEeCCccCCCCCCCccceE
Q 036777           33 VPGKVGMYVCGVTAYDLSHLGHARAA   58 (66)
Q Consensus        33 ~~~~v~~Y~CGPTvYd~~HiGhaR~~   58 (66)
                      .+..|++|.-|  +||.-|.||||..
T Consensus        60 ~~RPVRVYADG--IyDLFH~GHarqL   83 (348)
T KOG2804|consen   60 TDRPVRVYADG--IYDLFHYGHARQL   83 (348)
T ss_pred             CCCceEEEccc--hHHHhhhhHHHHH
Confidence            34679999988  7999999999963


No 55 
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed
Probab=82.01  E-value=0.14  Score=42.28  Aligned_cols=31  Identities=23%  Similarity=0.168  Sum_probs=26.3

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +-.++.--|++-...|+||+++++.-|++.|
T Consensus        42 ~f~i~~~PPy~nG~lH~GH~l~~t~kD~i~R   72 (975)
T PRK06039         42 EFVFYDGPPTANGLPHYGHLLTRTIKDVVPR   72 (975)
T ss_pred             CEEEeCCCCCCCCCccHhhhHhhHHHHHHHH
Confidence            3456677788889999999999999999876


No 56 
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional
Probab=81.97  E-value=0.17  Score=43.18  Aligned_cols=31  Identities=26%  Similarity=0.117  Sum_probs=27.5

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-.+|.--|++-..+|+||+.+++.-|++.|
T Consensus       103 ~Fv~~~gPPyanG~lHiGHal~~tikDii~R  133 (1205)
T PTZ00427        103 AYIFYDGPPFATGLPHYGHLLAGIIKDCVTR  133 (1205)
T ss_pred             cEEEecCCCCCCCCcchhHHHHHHHHHHHHH
Confidence            3667888899999999999999999999876


No 57 
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional
Probab=81.89  E-value=0.11  Score=42.99  Aligned_cols=29  Identities=21%  Similarity=0.056  Sum_probs=23.0

Q ss_pred             eeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           38 GMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        38 ~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      -+..--|.+-...|||||++++.-|++.|
T Consensus        57 ~l~dgPPyanG~lHiGHaln~~lkDii~R   85 (961)
T PRK13804         57 VLHDGPPYANGNIHIGHALNKILKDVIVR   85 (961)
T ss_pred             EEeCCCCCCCCCccHHHHHHHHHHHHHHH
Confidence            34444566679999999999999999876


No 58 
>PLN02843 isoleucyl-tRNA synthetase
Probab=80.91  E-value=0.14  Score=42.53  Aligned_cols=30  Identities=20%  Similarity=0.039  Sum_probs=25.0

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      --+..--|.+-...|||||.+++.-|++.|
T Consensus        34 f~i~~~PPy~nG~lHiGHa~~~~lkDii~R   63 (974)
T PLN02843         34 FTLHDGPPYANGDLHIGHALNKILKDFINR   63 (974)
T ss_pred             EEEeCCCCCCCCCcchhHHHHHHHHHHHHH
Confidence            445556688889999999999999999876


No 59 
>cd00853 NifX NifX belongs to a family of iron-molybdenum cluster-binding proteins that includes NifB,  and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme.  The protein is part of the nitrogen fixation gene cluster in nitrogen-fixing bacteria and has sequence similarity to other members of the cluster.
Probab=80.00  E-value=1.5  Score=26.43  Aligned_cols=15  Identities=27%  Similarity=0.414  Sum_probs=14.1

Q ss_pred             CCCCCccceEEEEEe
Q 036777           49 LSHLGHARAAISFYI   63 (66)
Q Consensus        49 ~~HiGhaR~~V~~Dv   63 (66)
                      ..|.||++.|+++|+
T Consensus        13 ~~HFG~a~~F~Iydv   27 (102)
T cd00853          13 DAHFGSARRFAIYEV   27 (102)
T ss_pred             ccccccCCEEEEEEE
Confidence            689999999999997


No 60 
>PF00133 tRNA-synt_1:  tRNA synthetases class I (I, L, M and V);  InterPro: IPR002300 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. The class Ia aminoacyl-tRNA synthetases consist of the isoleucyl, methionyl, valyl, leucyl, cysteinyl, and arginyl-tRNA synthetases; the class Ib include the glutamyl and glutaminyl-tRNA synthetases, and the class Ic are the tyrosyl and tryptophanyl-tRNA synthetases [].; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 1OBC_A 2AJH_B 4ARI_A 2AJG_B 4AQ7_D 2AJI_B 4ARC_A 4AS1_A 1QU3_A 1QU2_A ....
Probab=79.20  E-value=0.12  Score=40.34  Aligned_cols=30  Identities=20%  Similarity=-0.045  Sum_probs=21.7

Q ss_pred             eeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           37 VGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        37 v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      ..+..--|.+-...|+|||++++.-|++.|
T Consensus        25 f~i~~~PPy~nG~lH~GH~~~~~~~D~i~R   54 (601)
T PF00133_consen   25 FFIHDPPPYANGDLHIGHALNKTIKDIIAR   54 (601)
T ss_dssp             EEEEE---BTSSS-BHHHHHHHHHHHHHHH
T ss_pred             EEEEeCCCCCCCcccHHHHHHHHHHHHHHH
Confidence            445566678888999999999999998865


No 61 
>PLN02413 choline-phosphate cytidylyltransferase
Probab=77.61  E-value=1  Score=33.50  Aligned_cols=23  Identities=48%  Similarity=0.778  Sum_probs=19.4

Q ss_pred             CCCeeeeEEeCCccCCCCCCCccce
Q 036777           33 VPGKVGMYVCGVTAYDLSHLGHARA   57 (66)
Q Consensus        33 ~~~~v~~Y~CGPTvYd~~HiGhaR~   57 (66)
                      .+..+.+|+.|  ++|..|.||+|.
T Consensus        24 ~~r~~rVyvdG--~FDLfH~GHir~   46 (294)
T PLN02413         24 SDRPVRVYADG--IYDLFHFGHARS   46 (294)
T ss_pred             CCCceEEEEeC--chhhCCHHHHHH
Confidence            45678999997  799999999874


No 62 
>KOG0435 consensus Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=77.30  E-value=0.73  Score=38.34  Aligned_cols=23  Identities=26%  Similarity=0.193  Sum_probs=19.3

Q ss_pred             CccCCCCCCCccceEEEEEeeeC
Q 036777           44 VTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |=+-...||||.|.|...|+|.|
T Consensus        66 PYPSG~LHiGHvRVYTIsD~laR   88 (876)
T KOG0435|consen   66 PYPSGALHIGHVRVYTISDILAR   88 (876)
T ss_pred             CCCCCcccccceEEEEehHHHHH
Confidence            44446689999999999999876


No 63 
>PF00175 NAD_binding_1:  Oxidoreductase NAD-binding domain ;  InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes. Chloroplast ferredoxin-NADP+ reductase (1.18.1.2 from EC) may play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power. It is involved in the final step in the linear photosynthetic electron transport chain and has also been implicated in cyclic electron flow around photosystem I where its role would be to return electrons from ferredoxin to the cytochrome B-F complex. This domain is present in a variety of proteins that include, bacterial flavohemoprotein, mammalian NADH-cytochrome b5 reductase, eukaryotic NADPH-cytochrome P450 reductase, nitrate reductase from plants, nitric-oxide synthase, bacterial vanillate demethylase, as well as others.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1UMK_A 1CNE_A 2CND_A 1CNF_A 4FK8_A 4F7D_A 2XNJ_B 1FDR_A 1JB9_A 3LVB_A ....
Probab=75.67  E-value=1.3  Score=25.83  Aligned_cols=13  Identities=31%  Similarity=0.922  Sum_probs=10.1

Q ss_pred             CCeeeeEEeCCcc
Q 036777           34 PGKVGMYVCGVTA   46 (66)
Q Consensus        34 ~~~v~~Y~CGPTv   46 (66)
                      .....+|+|||..
T Consensus        90 ~~~~~v~iCGp~~  102 (109)
T PF00175_consen   90 PDDTHVYICGPPP  102 (109)
T ss_dssp             TTTEEEEEEEEHH
T ss_pred             CCCCEEEEECCHH
Confidence            4567899999963


No 64 
>TIGR02663 nifX nitrogen fixation protein NifX. Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the Pfam family pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor.
Probab=74.77  E-value=2.5  Score=26.40  Aligned_cols=15  Identities=20%  Similarity=0.437  Sum_probs=13.9

Q ss_pred             CCCCccceEEEEEee
Q 036777           50 SHLGHARAAISFYIL   64 (66)
Q Consensus        50 ~HiGhaR~~V~~Dvl   64 (66)
                      .|.|||+.|+++|+-
T Consensus        15 ~HFG~A~~F~Iyev~   29 (119)
T TIGR02663        15 AHFGSAKQFAIYDVT   29 (119)
T ss_pred             ccccCCCEEEEEEEe
Confidence            899999999999983


No 65 
>PF08030 NAD_binding_6:  Ferric reductase NAD binding domain;  InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=74.59  E-value=2.3  Score=26.58  Aligned_cols=13  Identities=38%  Similarity=1.002  Sum_probs=9.2

Q ss_pred             CCCeeeeEEeCCc
Q 036777           33 VPGKVGMYVCGVT   45 (66)
Q Consensus        33 ~~~~v~~Y~CGPT   45 (66)
                      ..+.+.+++|||.
T Consensus       133 ~~~~~~V~~CGP~  145 (156)
T PF08030_consen  133 SSGRVAVFVCGPP  145 (156)
T ss_dssp             TT-EEEEEEES-H
T ss_pred             CCCcEEEEEcCcH
Confidence            4568999999995


No 66 
>cd00851 MTH1175 This uncharacterized conserved protein belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, NifB, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme.  This domain is a predicted small-molecule-binding domain (SMBD) with an alpha/beta fold that is present either as a stand-alone domain (e.g. NifX and NifY) or fused to another conserved domain (e.g. NifB) however, its function is still undetermined.The SCOP database suggests that this domain is most similar to structures within the ribonuclease H superfamily.  This conserved domain is represented in two of the three major divisions of life (bacteria and archaea).
Probab=73.51  E-value=2.8  Score=24.56  Aligned_cols=16  Identities=19%  Similarity=0.293  Sum_probs=14.3

Q ss_pred             CCCCCCccceEEEEEe
Q 036777           48 DLSHLGHARAAISFYI   63 (66)
Q Consensus        48 d~~HiGhaR~~V~~Dv   63 (66)
                      -..|.|+|..|+++|+
T Consensus        14 v~~hFg~a~~f~i~d~   29 (103)
T cd00851          14 VSPHFGRAPYFLIYDV   29 (103)
T ss_pred             ccCccccCCEEEEEEc
Confidence            4689999999999996


No 67 
>cd00562 NifX_NifB This CD represents a family of iron-molybdenum cluster-binding proteins that includes NifB, NifX, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme.  This domain is a predicted small-molecule-binding domain (SMBD) with an alpha/beta fold that is present either as a stand-alone domain (e.g. NifX and NifY) or fused to another conserved domain (e.g. NifB) however, its function is still undetermined.The SCOP database suggests that this domain is most similar to structures within the ribonuclease H superfamily.  This conserved domain is represented in two of the three major divisions of life (bacteria and archaea).
Probab=67.02  E-value=3.9  Score=23.78  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=13.8

Q ss_pred             CCCCCccceEEEEEe
Q 036777           49 LSHLGHARAAISFYI   63 (66)
Q Consensus        49 ~~HiGhaR~~V~~Dv   63 (66)
                      ..|.|+|..|+++|+
T Consensus        13 ~~hFg~A~~f~I~d~   27 (102)
T cd00562          13 DQHFGRAPEFLIYEV   27 (102)
T ss_pred             hhhcCCCCeEEEEEE
Confidence            479999999999997


No 68 
>cd00852 NifB NifB belongs to a family of iron-molybdenum cluster-binding proteins that includes NifX, and NifY, all of which are involved in the synthesis of an iron-molybdenum cofactor (FeMo-co) that binds the active site of the dinitrogenase enzyme as part of nitrogen fixation in bacteria. This domain is sometimes found fused to a N-terminal domain (the Radical SAM domain) in nifB-like proteins.
Probab=66.09  E-value=4.8  Score=24.29  Aligned_cols=15  Identities=27%  Similarity=0.434  Sum_probs=13.9

Q ss_pred             CCCCCccceEEEEEe
Q 036777           49 LSHLGHARAAISFYI   63 (66)
Q Consensus        49 ~~HiGhaR~~V~~Dv   63 (66)
                      ..|.|+++.|.++|+
T Consensus        13 ~~HFG~a~~F~Iydv   27 (106)
T cd00852          13 NQHFGHATEFQIYEV   27 (106)
T ss_pred             hhhccCCCEEEEEEE
Confidence            589999999999997


No 69 
>PF02579 Nitro_FeMo-Co:  Dinitrogenase iron-molybdenum cofactor;  InterPro: IPR003731 This entry represents several Nif (B, X and Y) proteins, which are involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria. The nitrogenase complex catalyses the reduction of atmospheric dinitrogen to ammonia, and is composed of an iron metalloprotein (dinitrogenase reductase; homodimer of NifH; IPR000392 from INTERPRO) and a Fe-Mo metalloprotein (dinitrogenase; heterotetramer of NifD and NifK; IPR000318 from INTERPRO). The pathway for the synthesis of the Fe-Mo cofactor involves several proteins, including NifB, NifE, NifH, NifN, NifQ, NifV and NifX. NifB appears to be an iron-sulphur source for FeMo-co biosynthesis, while NifX may be associated with the mature FeMo-co, in particular with the addition of homocitrate during the last step of biosynthesis []. The NifX protein shows sequence similarity with the C terminus of NifB [], as well as to the conserved protein MTH1175 from the archaeon Methanobacterium thermoautotrophicum, which displays a ribonuclease H-like motif of three layers, alpha/beta/alpha, with a single mixed beta-sheet [].; PDB: 2QTD_A 2KLA_A 1EO1_A 1P90_A 1RDU_A 2YX6_D 1O13_A 1T3V_A 2RE2_B 2WFB_A.
Probab=64.87  E-value=6.2  Score=22.66  Aligned_cols=16  Identities=19%  Similarity=0.295  Sum_probs=12.7

Q ss_pred             CCCCCccceEEEEEee
Q 036777           49 LSHLGHARAAISFYIL   64 (66)
Q Consensus        49 ~~HiGhaR~~V~~Dvl   64 (66)
                      ..|.|+|..|.++|+-
T Consensus         6 ~~hFg~a~~f~I~d~~   21 (94)
T PF02579_consen    6 SPHFGRAPYFLIYDVE   21 (94)
T ss_dssp             -SBCTT-SEEEEEEEE
T ss_pred             eHHHCCCCEEEEEEEe
Confidence            4799999999999974


No 70 
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=63.96  E-value=1  Score=37.76  Aligned_cols=39  Identities=21%  Similarity=0.102  Sum_probs=30.4

Q ss_pred             EeeecCCC---eeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           28 LFTPIVPG---KVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        28 ~f~p~~~~---~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|.|..+.   .-.+=..-|.|=...|||||-.+...|+|.|
T Consensus        23 ~f~~~~~~~~~~f~I~~PPPNVTG~LHmGHAl~~tl~D~l~R   64 (877)
T COG0525          23 YFKPDPNEDKPPFSIDTPPPNVTGSLHMGHALNYTLQDILAR   64 (877)
T ss_pred             CccCCCCCCCCCcEEeCCCCCCCCcccchhhhhHHHHHHHHH
Confidence            55554322   2566678899999999999999999999876


No 71 
>cd02174 CCT CTP:phosphocholine cytidylyltransferase. CTP:phosphocholine cytidylyltransferase (CCT) catalyzes the condensation of CTP and phosphocholine to form CDP-choline as the rate-limiting and regulatory step in the CDP-choline pathway. CCT is unique in that its enzymatic activity is regulated by the extent of its association with membrane structures. A current model posts that the elastic stress of the bilayer curvature is sensed by CCT and this governs the degree of membrane association, thus providing a mechanism for both positive and negative regulation of activity.
Probab=61.30  E-value=4.1  Score=26.82  Aligned_cols=19  Identities=53%  Similarity=0.891  Sum_probs=15.6

Q ss_pred             eeeeEEeCCccCCCCCCCccc
Q 036777           36 KVGMYVCGVTAYDLSHLGHAR   56 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR   56 (66)
                      ..++|++|  .+|..|.||.+
T Consensus         2 ~~rV~~~G--~FDl~H~GHi~   20 (150)
T cd02174           2 PVRVYVDG--CFDLFHYGHAN   20 (150)
T ss_pred             CeEEEEeC--ccCCCCHHHHH
Confidence            35788887  69999999975


No 72 
>PLN02286 arginine-tRNA ligase
Probab=59.59  E-value=2.9  Score=32.92  Aligned_cols=32  Identities=19%  Similarity=0.113  Sum_probs=27.5

Q ss_pred             CeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           35 GKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        35 ~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+|-+=.+.|.+=...|+||+|+.+.=|.|.|
T Consensus       117 ~~v~VEfsSpNp~kplHvGHlRsaiiGdsLar  148 (576)
T PLN02286        117 KRAVVDFSSPNIAKEMHVGHLRSTIIGDTLAR  148 (576)
T ss_pred             ceEEEEecCCCCCCCCccccccchhhHHHHHH
Confidence            56777788999999999999999998887754


No 73 
>PF00749 tRNA-synt_1c:  tRNA synthetases class I (E and Q), catalytic domain;  InterPro: IPR020058 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c.  Glutamyl-tRNA synthetase (6.1.1.17 from EC) is a class Ic synthetase and shows several similarities with glutaminyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. To date one crystal structure of a glutamyl-tRNA synthetase (Thermus thermophilus) has been solved. The molecule has the form of a bent cylinder and consists of four domains. The N-terminal half (domains 1 and 2) contains the 'Rossman fold' typical for class I synthetases and resembles the corresponding part of Escherichia coli GlnRS, whereas the C-terminal half exhibits a GluRS-specific structure []. ; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0016876 ligase activity, forming aminoacyl-tRNA and related compounds, 0043039 tRNA aminoacylation, 0005737 cytoplasm; PDB: 2HZ7_A 2CFO_A 4A91_A 1NZJ_A 1N78_A 1G59_C 2CV2_A 2CV1_A 2CV0_B 1GLN_A ....
Probab=59.42  E-value=1.3  Score=32.34  Aligned_cols=17  Identities=35%  Similarity=0.556  Sum_probs=12.1

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++-.+.||||+|+++.
T Consensus         8 PsPtG~lHiG~~r~al~   24 (314)
T PF00749_consen    8 PSPTGYLHIGHARTALL   24 (314)
T ss_dssp             --SSSS-BHHHHHHHHH
T ss_pred             CCCCCCcccchhHHHHH
Confidence            67788999999998764


No 74 
>PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional
Probab=57.47  E-value=4.9  Score=30.09  Aligned_cols=25  Identities=44%  Similarity=0.925  Sum_probs=20.1

Q ss_pred             ecCCCeeeeEEeCCccCCCCCCCccce
Q 036777           31 PIVPGKVGMYVCGVTAYDLSHLGHARA   57 (66)
Q Consensus        31 p~~~~~v~~Y~CGPTvYd~~HiGhaR~   57 (66)
                      |..++.+.+|+.|  .+|..|+||.+.
T Consensus         6 ~~~~~~~~v~~~G--~FD~vH~GH~~~   30 (353)
T PTZ00308          6 PKKPGTIRVWVDG--CFDMLHFGHANA   30 (353)
T ss_pred             CCCCCcEEEEEEe--ecccCCHHHHHH
Confidence            3456778999987  799999999763


No 75 
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=57.36  E-value=2.6  Score=33.62  Aligned_cols=32  Identities=28%  Similarity=0.180  Sum_probs=25.7

Q ss_pred             CeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           35 GKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        35 ~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+|-+=.--|.+=.+.||||+|+-|.=|.|.|
T Consensus       117 ~kV~iE~sSaNptkplHiGHlR~aiiGDsLar  148 (577)
T COG0018         117 KKVVIEYSSANPTGPLHIGHLRNAIIGDSLAR  148 (577)
T ss_pred             CEEEEEEeCCCCCCCcccchhhhhHHHHHHHH
Confidence            45666666778889999999999998887765


No 76 
>PRK12558 glutamyl-tRNA synthetase; Provisional
Probab=56.24  E-value=2.1  Score=33.14  Aligned_cols=17  Identities=29%  Similarity=0.442  Sum_probs=14.4

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++-.+.||||+|++++
T Consensus         9 PSPTG~lHiG~artAL~   25 (445)
T PRK12558          9 PSPTGYLHVGNARTALL   25 (445)
T ss_pred             CCCCCcccHHHHHHHHH
Confidence            67788999999999764


No 77 
>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase. This protein resembles a shortened glutamyl-tRNA ligase, but its purpose is to modify tRNA(Asp) at a queuosine position in the anticodon rather than to charge a tRNA with its cognate amino acid.
Probab=55.67  E-value=0.62  Score=33.73  Aligned_cols=18  Identities=22%  Similarity=0.191  Sum_probs=14.5

Q ss_pred             CccCCCCCCCccceEEEE
Q 036777           44 VTAYDLSHLGHARAAISF   61 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~~   61 (66)
                      |++=.+.||||+|++++-
T Consensus         7 PSPtG~lHiG~~rtAL~n   24 (272)
T TIGR03838         7 PSPSGPLHFGSLVAALGS   24 (272)
T ss_pred             CCCCCcccHHHHHHHHHH
Confidence            566788999999998653


No 78 
>PRK12451 arginyl-tRNA synthetase; Reviewed
Probab=55.48  E-value=2.8  Score=32.80  Aligned_cols=33  Identities=15%  Similarity=0.045  Sum_probs=27.1

Q ss_pred             CCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           34 PGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        34 ~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.+|-+=...|.+=...|+||+|+.+.=|.|.|
T Consensus       112 ~~~v~vE~sSpNp~kplHvGH~R~aiiGd~l~r  144 (562)
T PRK12451        112 EKTVVIDYSSPNIAKPFSMGHLRSTMIGNALKH  144 (562)
T ss_pred             CCEEEEEecCCCCCCCcccchhhhHHHHHHHHH
Confidence            346777778889999999999999988777754


No 79 
>KOG0432 consensus Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=55.25  E-value=1.3  Score=37.48  Aligned_cols=33  Identities=18%  Similarity=0.048  Sum_probs=28.2

Q ss_pred             CCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           34 PGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        34 ~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+...|+..-|.|=...|||||-+.-.-|.|.|
T Consensus        74 ~~~f~i~~PPPNVTG~LHiGHALt~aiqD~i~R  106 (995)
T KOG0432|consen   74 GGVFVIPLPPPNVTGSLHIGHALTVAIQDALAR  106 (995)
T ss_pred             CCcceeecCCCCcccccchhHHHHHHHHHHHHH
Confidence            455679999999999999999999888887765


No 80 
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in many organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in 
Probab=53.73  E-value=8  Score=25.07  Aligned_cols=12  Identities=33%  Similarity=0.731  Sum_probs=9.4

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||.-
T Consensus       190 ~~~~~yvCGp~~  201 (223)
T cd00322         190 SGALVYICGPPA  201 (223)
T ss_pred             cCCEEEEECCHH
Confidence            456799999974


No 81 
>TIGR03330 SAM_DCase_Bsu S-adenosylmethionine decarboxylase proenzyme, Bacillus form. Members of this protein family are the single chain precursor of the two chains of the mature S-adenosylmethionine decarboxylase as found in Methanocaldococcus jannaschii, Bacillus subtilis, and a wide range of other species. It differs substantially in architecture from the form as found in Escherichia coli, and lacks any extended homology to the eukaryotic form (TIGR00535).
Probab=53.41  E-value=8.2  Score=24.36  Aligned_cols=11  Identities=27%  Similarity=0.782  Sum_probs=9.3

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||+++
T Consensus        76 avDiftCg~~~   86 (112)
T TIGR03330        76 AVDVFTCGDHS   86 (112)
T ss_pred             EEEEEecCCCC
Confidence            48999999864


No 82 
>PRK03124 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=53.05  E-value=8.4  Score=25.03  Aligned_cols=11  Identities=27%  Similarity=0.754  Sum_probs=9.4

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||+++
T Consensus        77 avDiftCg~~~   87 (127)
T PRK03124         77 AVDVFTCGDRV   87 (127)
T ss_pred             EEEEEecCCCC
Confidence            48999999975


No 83 
>PRK01706 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=52.63  E-value=8.7  Score=24.84  Aligned_cols=11  Identities=36%  Similarity=0.920  Sum_probs=9.4

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||.++
T Consensus        79 avDiftCg~~~   89 (123)
T PRK01706         79 AIDCYTCGTTV   89 (123)
T ss_pred             EEEEEecCCCC
Confidence            48999999975


No 84 
>PLN02200 adenylate kinase family protein
Probab=52.17  E-value=11  Score=26.12  Aligned_cols=45  Identities=18%  Similarity=0.152  Sum_probs=29.0

Q ss_pred             CcccccccccCCCcceEEEeCCCCceEEeee-----cCCCeeeeEEeCCc
Q 036777            1 METSKETTAAAPKMDLIIYNSMTQQKELFTP-----IVPGKVGMYVCGVT   45 (66)
Q Consensus         1 ~~~~~~~~~~~~~~~l~lyntltr~ke~f~p-----~~~~~v~~Y~CGPT   45 (66)
                      |..||-........+|+++|+.+.+...+.-     .......+.++||.
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~I~G~P   52 (234)
T PLN02200          3 MSSSKPLKLSQAASGLKIWESFSTEIITLEERGSSSKEKTPFITFVLGGP   52 (234)
T ss_pred             cccCCcchHHHHhhhheecccccccccccccccCCccCCCCEEEEEECCC
Confidence            4556666666666789999999986444432     11123567888874


No 85 
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]
Probab=52.09  E-value=24  Score=26.95  Aligned_cols=37  Identities=11%  Similarity=0.092  Sum_probs=24.4

Q ss_pred             cccccccCCCcceEEEeCCCCceE-EeeecCCCeeeeEE
Q 036777            4 SKETTAAAPKMDLIIYNSMTQQKE-LFTPIVPGKVGMYV   41 (66)
Q Consensus         4 ~~~~~~~~~~~~l~lyntltr~ke-~f~p~~~~~v~~Y~   41 (66)
                      +.-++|.....-+|||||.++++. +|.- .-.+..+|+
T Consensus       194 t~vATaStkGTLIRIFdt~~g~~l~E~RR-G~d~A~iy~  231 (346)
T KOG2111|consen  194 TLVATASTKGTLIRIFDTEDGTLLQELRR-GVDRADIYC  231 (346)
T ss_pred             cEEEEeccCcEEEEEEEcCCCcEeeeeec-CCchheEEE
Confidence            345677777788999999998753 3432 223556665


No 86 
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.
Probab=51.91  E-value=9.9  Score=26.46  Aligned_cols=12  Identities=25%  Similarity=0.830  Sum_probs=9.4

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||..
T Consensus       248 ~~~~vyiCGP~~  259 (283)
T cd06188         248 EDIEFYLCGPPP  259 (283)
T ss_pred             CCeEEEEECCHH
Confidence            356799999974


No 87 
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal  FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD
Probab=49.59  E-value=9.6  Score=26.15  Aligned_cols=9  Identities=44%  Similarity=1.114  Sum_probs=7.8

Q ss_pred             eeeEEeCCc
Q 036777           37 VGMYVCGVT   45 (66)
Q Consensus        37 v~~Y~CGPT   45 (66)
                      ..+|+|||.
T Consensus       203 ~~vy~CGp~  211 (245)
T cd06200         203 AAIYVCGSL  211 (245)
T ss_pred             cEEEEECCc
Confidence            469999997


No 88 
>PF00750 tRNA-synt_1d:  tRNA synthetases class I (R);  InterPro: IPR015945 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This entry represents the core region of arginyl-tRNA synthetase (6.1.1.19 from EC), which has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available []. ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 2ZUE_A 2ZUF_A 3FNR_A 1IQ0_A 1F7V_A 1F7U_A 1BS2_A 3GDZ_B.
Probab=49.44  E-value=0.95  Score=33.31  Aligned_cols=33  Identities=24%  Similarity=0.118  Sum_probs=22.5

Q ss_pred             CCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           34 PGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        34 ~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +.+|-+=.+-|.+=...|+||+|+.+.=|.|.|
T Consensus        19 ~~kv~VE~sSpNp~kplHvGHlR~~iiGd~lar   51 (354)
T PF00750_consen   19 GKKVVVEFSSPNPTKPLHVGHLRNTIIGDSLAR   51 (354)
T ss_dssp             SEEEEEEE---BTTSS-BHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEecCCCCCCCCcCCcchhhhhhHHHHH
Confidence            456667778888999999999999887666543


No 89 
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]
Probab=49.11  E-value=1.2  Score=34.82  Aligned_cols=19  Identities=32%  Similarity=0.492  Sum_probs=14.9

Q ss_pred             eCCccCCCCCCCccceEEE
Q 036777           42 CGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        42 CGPTvYd~~HiGhaR~~V~   60 (66)
                      .=|.+=.+.||||||+.++
T Consensus        14 FAPsPtG~LHiG~artAl~   32 (472)
T COG0008          14 FAPSPTGYLHIGHARTALL   32 (472)
T ss_pred             ECcCCCCccchHHHHHHHH
Confidence            3456678899999998764


No 90 
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide. ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single  transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation.
Probab=48.85  E-value=14  Score=24.07  Aligned_cols=8  Identities=38%  Similarity=0.866  Sum_probs=6.6

Q ss_pred             eEEeCCcc
Q 036777           39 MYVCGVTA   46 (66)
Q Consensus        39 ~Y~CGPTv   46 (66)
                      +|+|||.-
T Consensus       179 v~~CGp~~  186 (210)
T cd06186         179 VVVCGPPG  186 (210)
T ss_pred             EEEECchh
Confidence            89999953


No 91 
>PLN03233 putative glutamate-tRNA ligase; Provisional
Probab=47.61  E-value=1.2  Score=35.30  Aligned_cols=18  Identities=33%  Similarity=0.434  Sum_probs=14.2

Q ss_pred             CccCCCCCCCccceEEEE
Q 036777           44 VTAYDLSHLGHARAAISF   61 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~~   61 (66)
                      |.+=.+.||||||++++-
T Consensus        18 PsPtG~LHiGharaAlln   35 (523)
T PLN03233         18 PEPSGYLHIGHAKAALLN   35 (523)
T ss_pred             CCCCCcccHHHHHHHHHH
Confidence            566688999999987643


No 92 
>PLN02907 glutamate-tRNA ligase
Probab=47.08  E-value=1.3  Score=36.14  Aligned_cols=21  Identities=29%  Similarity=0.303  Sum_probs=16.5

Q ss_pred             EeCCccCCCCCCCccceEEEE
Q 036777           41 VCGVTAYDLSHLGHARAAISF   61 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~   61 (66)
                      -.-|.+=.+.||||||++++-
T Consensus       217 RFaPsPtG~LHiG~ar~al~n  237 (722)
T PLN02907        217 RFPPEPSGYLHIGHAKAALLN  237 (722)
T ss_pred             eeCCCCCCcccHHHHHHHHHH
Confidence            445777889999999987653


No 93 
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of  ferredoxin reductase-like proteins. Ferredoxin reductase (FNR) was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and have a variety of physiological  functions in a variety of organisms including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which varies in orientation with respect  to the NAD(P) binding domain. The N-terminal moeity 
Probab=46.58  E-value=10  Score=25.57  Aligned_cols=9  Identities=44%  Similarity=1.080  Sum_probs=7.5

Q ss_pred             eeEEeCCcc
Q 036777           38 GMYVCGVTA   46 (66)
Q Consensus        38 ~~Y~CGPTv   46 (66)
                      .+|+|||.-
T Consensus       192 ~v~~CGP~~  200 (220)
T cd06197         192 EVYLCGPPA  200 (220)
T ss_pred             cEEEECcHH
Confidence            689999973


No 94 
>PRK00458 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=45.09  E-value=13  Score=24.10  Aligned_cols=11  Identities=36%  Similarity=0.893  Sum_probs=9.4

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||++.
T Consensus        89 avDiftCg~~~   99 (127)
T PRK00458         89 TVDVYTCGEHT   99 (127)
T ss_pred             EEEEEecCCCC
Confidence            48999999875


No 95 
>PRK02770 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=45.05  E-value=13  Score=24.56  Aligned_cols=11  Identities=27%  Similarity=0.767  Sum_probs=9.1

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||+++
T Consensus        90 avDiftCg~~~  100 (139)
T PRK02770         90 AVDVFTCGDHT  100 (139)
T ss_pred             EEEEEecCCCC
Confidence            48999999864


No 96 
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain. Ferredoxin-NADP+ reductase (FNR) is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins, such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then
Probab=44.66  E-value=13  Score=26.01  Aligned_cols=12  Identities=25%  Similarity=0.902  Sum_probs=9.0

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      +...+|+|||.-
T Consensus       238 ~~~~vYiCGp~~  249 (286)
T cd06208         238 DNTHVYICGLKG  249 (286)
T ss_pred             CCcEEEEeCCch
Confidence            345799999963


No 97 
>TIGR00440 glnS glutaminyl-tRNA synthetase. This protein is a relatively rare aminoacyl-tRNA synthetase, found in the cytosolic compartment of eukaryotes, in E. coli and a number of other Gram-negative Bacteria, and in Deinococcus radiodurans. In contrast, the pathway to Gln-tRNA in mitochondria, Archaea, Gram-positive Bacteria, and a number of other lineages is by misacylation with Glu followed by transamidation to correct the aminoacylation to Gln. This enzyme is a class I tRNA synthetase (hit by the pfam model tRNA-synt_1c) and is quite closely related to glutamyl-tRNA synthetases.
Probab=44.50  E-value=1.4  Score=34.82  Aligned_cols=19  Identities=21%  Similarity=0.246  Sum_probs=14.8

Q ss_pred             CCccCCCCCCCccceEEEE
Q 036777           43 GVTAYDLSHLGHARAAISF   61 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~~   61 (66)
                      -|.+=.+.||||||++++-
T Consensus         6 aPsPtG~LHiG~ar~al~n   24 (522)
T TIGR00440         6 PPEPNGYLHIGHAKSICLN   24 (522)
T ss_pred             CCCCCCcccHHHHHHHHHH
Confidence            3667788999999987643


No 98 
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.
Probab=44.19  E-value=14  Score=24.50  Aligned_cols=12  Identities=17%  Similarity=0.451  Sum_probs=9.3

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||.-
T Consensus       195 ~~~~vyiCGp~~  206 (232)
T cd06190         195 AEFEFYFAGPPP  206 (232)
T ss_pred             cccEEEEECCHH
Confidence            346899999973


No 99 
>PTZ00402 glutamyl-tRNA synthetase; Provisional
Probab=43.95  E-value=1.5  Score=35.36  Aligned_cols=19  Identities=37%  Similarity=0.461  Sum_probs=15.3

Q ss_pred             CCccCCCCCCCccceEEEE
Q 036777           43 GVTAYDLSHLGHARAAISF   61 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~~   61 (66)
                      -|.+=.+.||||||++++-
T Consensus        58 APsPtGyLHIGharaAllN   76 (601)
T PTZ00402         58 PPEASGFLHIGHAKAALIN   76 (601)
T ss_pred             CCCCCCcccHHHHHHHHHH
Confidence            4677789999999987653


No 100
>PRK04025 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=43.88  E-value=14  Score=24.42  Aligned_cols=11  Identities=36%  Similarity=0.896  Sum_probs=9.2

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||+++
T Consensus        77 avDIftCg~~~   87 (139)
T PRK04025         77 ALDVYTCGEKA   87 (139)
T ss_pred             EEEEEecCCCC
Confidence            48999999874


No 101
>PRK05347 glutaminyl-tRNA synthetase; Provisional
Probab=43.85  E-value=1.5  Score=35.04  Aligned_cols=21  Identities=19%  Similarity=0.178  Sum_probs=16.1

Q ss_pred             EeCCccCCCCCCCccceEEEE
Q 036777           41 VCGVTAYDLSHLGHARAAISF   61 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~~   61 (66)
                      -.-|.+=.+.||||||++++-
T Consensus        33 RFaPsPtG~LHiG~ar~al~n   53 (554)
T PRK05347         33 RFPPEPNGYLHIGHAKSICLN   53 (554)
T ss_pred             EeCCCCCCcccHHHHHHHHHH
Confidence            345677789999999987643


No 102
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase. Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers.  Archaea, cellular organelles, and some bacteria lack GlnRS.  In these cases, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The discriminating form of GluRS differs from GlnRS and the non-discriminating form of GluRS in their C-terminal anti-codon bind
Probab=43.24  E-value=4.1  Score=28.91  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=14.4

Q ss_pred             CCccCCCCCCCccceEEE
Q 036777           43 GVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~   60 (66)
                      -|++=.+.||||+|+++.
T Consensus         7 APsPtG~lHlG~~r~al~   24 (230)
T cd00418           7 APSPTGYLHIGHARTALF   24 (230)
T ss_pred             CCCCCCcccHHHHHHHHH
Confidence            356778899999998764


No 103
>PRK01236 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=43.01  E-value=15  Score=24.03  Aligned_cols=11  Identities=27%  Similarity=0.842  Sum_probs=9.2

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .|++|+||+++
T Consensus        78 avDiftCg~~~   88 (131)
T PRK01236         78 TLDVYTCGDPS   88 (131)
T ss_pred             EEEEEecCCCC
Confidence            48999999874


No 104
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=41.49  E-value=18  Score=23.74  Aligned_cols=9  Identities=44%  Similarity=0.973  Sum_probs=7.7

Q ss_pred             eeeEEeCCc
Q 036777           37 VGMYVCGVT   45 (66)
Q Consensus        37 v~~Y~CGPT   45 (66)
                      ..+|+|||.
T Consensus       187 ~~vyiCGp~  195 (218)
T cd06196         187 QHFYVCGPP  195 (218)
T ss_pred             CEEEEECCH
Confidence            569999996


No 105
>PRK08051 fre FMN reductase; Validated
Probab=41.04  E-value=15  Score=24.69  Aligned_cols=10  Identities=20%  Similarity=0.511  Sum_probs=8.1

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||..
T Consensus       195 ~~vyicGp~~  204 (232)
T PRK08051        195 YDIYIAGRFE  204 (232)
T ss_pred             CEEEEECCHH
Confidence            4699999964


No 106
>cd06198 FNR_like_3 NAD(P) binding domain of  ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=40.10  E-value=18  Score=23.76  Aligned_cols=11  Identities=18%  Similarity=0.709  Sum_probs=8.8

Q ss_pred             CeeeeEEeCCc
Q 036777           35 GKVGMYVCGVT   45 (66)
Q Consensus        35 ~~v~~Y~CGPT   45 (66)
                      ....+|+|||.
T Consensus       180 ~~~~vyicGp~  190 (216)
T cd06198         180 ADADVWFCGPP  190 (216)
T ss_pred             CCCeEEEECcH
Confidence            45679999996


No 107
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.
Probab=40.03  E-value=19  Score=23.90  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=8.8

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       190 ~~~v~vCGp~~  200 (224)
T cd06189         190 DFDVYACGSPE  200 (224)
T ss_pred             ccEEEEECCHH
Confidence            46799999964


No 108
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB. This model describes NifB, a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase. Archaeal homologs lack the most C-terminal region and score between the trusted and noise cutoffs of this model.
Probab=39.47  E-value=20  Score=27.38  Aligned_cols=26  Identities=27%  Similarity=0.258  Sum_probs=18.7

Q ss_pred             eeEEeCCc---cCCCCCCCccceEEEEEe
Q 036777           38 GMYVCGVT---AYDLSHLGHARAAISFYI   63 (66)
Q Consensus        38 ~~Y~CGPT---vYd~~HiGhaR~~V~~Dv   63 (66)
                      .|+++=+|   .--..|.|||..|+++|+
T Consensus       330 ~~kVAVas~~g~~Vn~HFG~A~~F~Iyev  358 (442)
T TIGR01290       330 ECLVAVATKGGGAVNQHFGHADEFTIFSL  358 (442)
T ss_pred             ceEEEEEcCCCCchhhhcCCCCeEEEEEE
Confidence            34444444   234689999999999997


No 109
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]
Probab=39.16  E-value=2.8  Score=33.41  Aligned_cols=28  Identities=18%  Similarity=0.350  Sum_probs=22.2

Q ss_pred             eEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           39 MYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        39 ~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      +..-|.|+-...||||+|-.+..|+++|
T Consensus        22 ~v~tGisPSG~~HIGn~rEv~t~d~V~r   49 (521)
T COG1384          22 VVATGISPSGLIHIGNFREVLTADAVRR   49 (521)
T ss_pred             EEecCcCCCCCcccccHHHHHHHHHHHH
Confidence            4556999999999999997776666543


No 110
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal ferredoxin reducatase (FNR)- like FAD and NAD binding module, an FMN-binding domain, and an additional conecting domain (inserted within the FAD binding region) that orients the FNR and FMN binding domains. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-t
Probab=39.14  E-value=17  Score=25.45  Aligned_cols=9  Identities=44%  Similarity=1.025  Sum_probs=8.1

Q ss_pred             eeEEeCCcc
Q 036777           38 GMYVCGVTA   46 (66)
Q Consensus        38 ~~Y~CGPTv   46 (66)
                      .+|+|||..
T Consensus       216 ~vyvCGp~~  224 (267)
T cd06182         216 HIYVCGDAK  224 (267)
T ss_pred             EEEEECCcc
Confidence            799999976


No 111
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol. This protein is encoded by a single gene and uses a tightly bound FAD cofactor in the NAD(P)H dependent conversion of phenol and O2 to catechol and H2O. This group is related to the NAD binding ferredoxin reductases.
Probab=39.10  E-value=19  Score=24.11  Aligned_cols=11  Identities=27%  Similarity=0.649  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||.-
T Consensus       204 ~~~vyvCGp~~  214 (238)
T cd06211         204 GHKAYLCGPPP  214 (238)
T ss_pred             cCEEEEECCHH
Confidence            45799999963


No 112
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. These flavoprotein monooxygenases use molecular oxygen as a substrate and require reduced FAD. One atom of oxygen is incorportated into the aromatic compond, while the other is used to form a molecule of water. In contrast dioxygenases add both atoms of oxygen to the substrate.
Probab=39.03  E-value=17  Score=24.12  Aligned_cols=11  Identities=27%  Similarity=0.815  Sum_probs=8.6

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||.-
T Consensus       197 ~~~v~~CGp~~  207 (232)
T cd06212         197 GCDVYLCGPPP  207 (232)
T ss_pred             CCEEEEECCHH
Confidence            45799999963


No 113
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type  [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=39.00  E-value=20  Score=23.55  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=9.7

Q ss_pred             CeeeeEEeCCccC
Q 036777           35 GKVGMYVCGVTAY   47 (66)
Q Consensus        35 ~~v~~Y~CGPTvY   47 (66)
                      +...+|+|||...
T Consensus       189 ~~~~v~vcGp~~~  201 (224)
T cd06187         189 ADHDIYICGPPAM  201 (224)
T ss_pred             ccCEEEEECCHHH
Confidence            3467999999753


No 114
>PRK10926 ferredoxin-NADP reductase; Provisional
Probab=38.87  E-value=20  Score=24.63  Aligned_cols=11  Identities=18%  Similarity=0.507  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       206 ~~~vy~CGp~~  216 (248)
T PRK10926        206 TSHVMLCGNPQ  216 (248)
T ss_pred             CCEEEEECCHH
Confidence            35699999964


No 115
>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional
Probab=38.69  E-value=5.6  Score=30.76  Aligned_cols=17  Identities=35%  Similarity=0.372  Sum_probs=14.1

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++=.+.||||+|++++
T Consensus         6 PSPTG~LHiG~artAL~   22 (433)
T PRK12410          6 PSPTGDMHIGNLRAAIF   22 (433)
T ss_pred             CCCCCcccHHHHHHHHH
Confidence            56678899999999764


No 116
>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase. Discriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain . The discriminating form of GluRS is only found in bacteria and cellular organelles. GluRS is a monomer that attaches Glu to the appropriate tRNA.  Like other class I tRNA synthetases, GluRS aminoacylates the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=38.43  E-value=5.4  Score=28.38  Aligned_cols=18  Identities=28%  Similarity=0.421  Sum_probs=14.0

Q ss_pred             CCccCCCCCCCccceEEE
Q 036777           43 GVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~   60 (66)
                      -|++=.+.||||+|+++.
T Consensus         7 APsPtG~LHlG~~~~al~   24 (239)
T cd00808           7 APSPTGFLHIGGARTALF   24 (239)
T ss_pred             CCCCCCcccHHHHHHHHH
Confidence            366778899999988653


No 117
>PTZ00319 NADH-cytochrome B5 reductase; Provisional
Probab=38.42  E-value=19  Score=25.64  Aligned_cols=12  Identities=33%  Similarity=0.570  Sum_probs=9.5

Q ss_pred             eeeeEEeCCccC
Q 036777           36 KVGMYVCGVTAY   47 (66)
Q Consensus        36 ~v~~Y~CGPTvY   47 (66)
                      ...+|+|||...
T Consensus       267 ~~~vyiCGp~~m  278 (300)
T PTZ00319        267 KVMALMCGPPPM  278 (300)
T ss_pred             CeEEEEECCHHH
Confidence            457999999764


No 118
>PLN03116 ferredoxin--NADP+ reductase; Provisional
Probab=37.71  E-value=18  Score=25.77  Aligned_cols=10  Identities=30%  Similarity=0.933  Sum_probs=8.0

Q ss_pred             eeeeEEeCCc
Q 036777           36 KVGMYVCGVT   45 (66)
Q Consensus        36 ~v~~Y~CGPT   45 (66)
                      ...+|+|||.
T Consensus       259 ~~~vYiCGp~  268 (307)
T PLN03116        259 GAHIYFCGLK  268 (307)
T ss_pred             CcEEEEeCCH
Confidence            3579999994


No 119
>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family. The glutamyl-tRNA synthetases of the eukaryotic cytosol and of the Archaea are more similar to glutaminyl-tRNA synthetases than to bacterial glutamyl-tRNA synthetases. This alignment models just the bacterial and mitochondrial forms of the enzyme. In many species, the charging of tRNA(gln) proceeds first through misacylation with Glu and then transamidation. For this reason, glutamyl-tRNA synthetases may act on both tRNA(gln) and tRNA(glu). This model is highly specific. Proteins with positive scores below the trusted cutoff may be fragments rather than full-length sequences.
Probab=37.53  E-value=2  Score=33.10  Aligned_cols=17  Identities=29%  Similarity=0.397  Sum_probs=13.8

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++=.+.||||+|+++.
T Consensus         8 PsPtG~lHiG~~rtal~   24 (470)
T TIGR00464         8 PSPTGYLHIGGARTALF   24 (470)
T ss_pred             CCCCCcccHHHHHHHHH
Confidence            56667899999998764


No 120
>cd06165 Sortase_A_1 Sortase A (SrtA) or subfamily-1 sortases are cysteine transpeptidases found in gram-positive bacteria that anchor surface proteins to peptidoglycans of the bacterial cell wall envelope. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall sorting signal (usually a pentapeptide motif), and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. This group contains a subset of Class A (subfamily-1) sortases, excluding SrtA from Staphylococcus aureus. Sortase A cleaves between threonine and glycine of the LPXTG motif in a wide range of protein substrates. It affects the ability of a pathogen to establish successful infection. Sortase A contains an N-terminal region that functions as both a signal peptide for secretion and a stop-tra
Probab=37.46  E-value=63  Score=19.99  Aligned_cols=17  Identities=6%  Similarity=0.221  Sum_probs=13.0

Q ss_pred             eeecC-CCeeeeEEeCCc
Q 036777           29 FTPIV-PGKVGMYVCGVT   45 (66)
Q Consensus        29 f~p~~-~~~v~~Y~CGPT   45 (66)
                      +.|.. +..+.+.+|.|.
T Consensus        97 ~~~~~~~~~ltLiTC~p~  114 (127)
T cd06165          97 IDDVPGKKLITLITCDDA  114 (127)
T ss_pred             eccCCCCCEEEEEecCCC
Confidence            44444 578999999998


No 121
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.
Probab=37.13  E-value=22  Score=23.86  Aligned_cols=12  Identities=17%  Similarity=0.443  Sum_probs=9.2

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||.-
T Consensus       200 ~~~~vyiCGp~~  211 (241)
T cd06195         200 ETSHVMLCGNPQ  211 (241)
T ss_pred             ccCEEEEeCCHH
Confidence            345799999974


No 122
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in
Probab=36.91  E-value=18  Score=24.00  Aligned_cols=10  Identities=20%  Similarity=0.737  Sum_probs=8.4

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||..
T Consensus       198 ~~vyicGp~~  207 (231)
T cd06191         198 REAFICGPAG  207 (231)
T ss_pred             CeEEEECCHH
Confidence            5799999975


No 123
>PTZ00437 glutaminyl-tRNA synthetase; Provisional
Probab=36.72  E-value=2.2  Score=34.24  Aligned_cols=26  Identities=23%  Similarity=0.333  Sum_probs=19.3

Q ss_pred             CCeeeeEEeCCccCCCCCCCccceEEE
Q 036777           34 PGKVGMYVCGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        34 ~~~v~~Y~CGPTvYd~~HiGhaR~~V~   60 (66)
                      +|+| +--..|.+-.+.||||||++++
T Consensus        49 ~gkv-~tRFaPsPtG~LHiGharaall   74 (574)
T PTZ00437         49 GGKP-YFRFPPEPNGFLHIGHAKSMNL   74 (574)
T ss_pred             CCcE-EEEeCCCCCCcccHHHHHHHHH
Confidence            3444 3456788889999999998764


No 124
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second e
Probab=36.67  E-value=20  Score=23.62  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=9.2

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||..
T Consensus       186 ~~~~vyicGp~~  197 (222)
T cd06194         186 RDDVVYLCGAPS  197 (222)
T ss_pred             CCCEEEEeCCHH
Confidence            346799999964


No 125
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain.  In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.
Probab=36.62  E-value=23  Score=23.47  Aligned_cols=12  Identities=42%  Similarity=1.068  Sum_probs=9.1

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||.-
T Consensus       192 ~~~~v~icGp~~  203 (228)
T cd06209         192 GDVDVYLCGPPP  203 (228)
T ss_pred             CCcEEEEeCCHH
Confidence            456799999963


No 126
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed
Probab=36.53  E-value=6.1  Score=29.09  Aligned_cols=19  Identities=21%  Similarity=0.225  Sum_probs=15.0

Q ss_pred             eCCccCCCCCCCccceEEE
Q 036777           42 CGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        42 CGPTvYd~~HiGhaR~~V~   60 (66)
                      .-|++=.+.||||+|+++.
T Consensus        10 FAPSPTG~LHlG~~rtAL~   28 (299)
T PRK05710         10 FAPSPSGPLHFGSLVAALG   28 (299)
T ss_pred             eCcCCCCcccHHHHHHHHH
Confidence            3467778899999998764


No 127
>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional
Probab=36.28  E-value=2.2  Score=35.17  Aligned_cols=19  Identities=21%  Similarity=0.354  Sum_probs=15.3

Q ss_pred             eCCccCCCCCCCccceEEE
Q 036777           42 CGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        42 CGPTvYd~~HiGhaR~~V~   60 (66)
                      .-|.+-.+.||||||++++
T Consensus        36 FaPsPtG~lHiGhar~all   54 (771)
T PRK14703         36 FPPEPNGYLHIGHAKSILL   54 (771)
T ss_pred             eCcCCCCcccHHHHHHHHH
Confidence            4567778999999998764


No 128
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate while mono-oxygenases add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with  Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=36.17  E-value=20  Score=23.75  Aligned_cols=11  Identities=36%  Similarity=0.803  Sum_probs=8.6

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .-.+|+|||..
T Consensus       193 ~~~v~~CGp~~  203 (227)
T cd06213         193 ATEAYLCGPPA  203 (227)
T ss_pred             CCEEEEECCHH
Confidence            35799999964


No 129
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur pr
Probab=35.83  E-value=21  Score=23.54  Aligned_cols=10  Identities=30%  Similarity=0.813  Sum_probs=8.2

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||.-
T Consensus       198 ~~v~icGp~~  207 (231)
T cd06215         198 RTVFVCGPAG  207 (231)
T ss_pred             CeEEEECCHH
Confidence            5799999964


No 130
>cd06166 Sortase_D_5 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-5, represented by Clostridium perfringens CPE2315. Subfamily-5 sortases recognize a nonstandard sorting signal (LAXTG) and have replaced Sortase A in some gram-postive bacteria. They may play a housekeeping role in the cell.
Probab=35.79  E-value=74  Score=19.79  Aligned_cols=18  Identities=6%  Similarity=0.252  Sum_probs=13.0

Q ss_pred             EEeeecC-CCeeeeEEeCC
Q 036777           27 ELFTPIV-PGKVGMYVCGV   44 (66)
Q Consensus        27 e~f~p~~-~~~v~~Y~CGP   44 (66)
                      +.+.+.. +..+.+.+|+|
T Consensus        96 ~~~~~~~~~~~LtLiTC~~  114 (126)
T cd06166          96 DVLNQDKSKKEITLITCTP  114 (126)
T ss_pred             eEeccCCCCcEEEEEEcCC
Confidence            3344444 57899999999


No 131
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain. The reductase portion is similar in structure to NADPH dependent cytochrome-450 reductase (CYPOR), having an  inserted connecting sub-domain within the FAD binding portion of FNR. NOS differs from CYPOR in a requirement for the cofactor tetrahydrobiopterin and unlike most CYPOR is dimeric. Nitric oxide synthase produces nitric oxide in the conversion of L-arginine to L-citruline. NOS has been implicated in a variety of processes including cytotoxicity, anti-inflamation, neurotransmission, and vascular smooth muscle relaxation.
Probab=35.27  E-value=22  Score=26.55  Aligned_cols=11  Identities=36%  Similarity=0.676  Sum_probs=8.8

Q ss_pred             CeeeeEEeCCc
Q 036777           35 GKVGMYVCGVT   45 (66)
Q Consensus        35 ~~v~~Y~CGPT   45 (66)
                      +...+|+|||.
T Consensus       349 ~~~~iYvCG~~  359 (406)
T cd06202         349 EGGHIYVCGDV  359 (406)
T ss_pred             CCCEEEEeCCC
Confidence            34679999996


No 132
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal  ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.
Probab=34.83  E-value=22  Score=23.11  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       176 ~~~vyicGp~~  186 (211)
T cd06185         176 GTHVYVCGPEG  186 (211)
T ss_pred             CCEEEEECCHH
Confidence            45799999964


No 133
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form 
Probab=34.70  E-value=22  Score=23.44  Aligned_cols=11  Identities=45%  Similarity=0.833  Sum_probs=8.6

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      .-.+|+|||..
T Consensus       201 ~~~v~icGp~~  211 (235)
T cd06217         201 GRRVYVCGPPA  211 (235)
T ss_pred             CCEEEEECCHH
Confidence            35799999964


No 134
>PF13293 DUF4074:  Domain of unknown function (DUF4074)
Probab=34.68  E-value=22  Score=21.15  Aligned_cols=15  Identities=33%  Similarity=0.662  Sum_probs=12.7

Q ss_pred             eCCccCCCCCCCccc
Q 036777           42 CGVTAYDLSHLGHAR   56 (66)
Q Consensus        42 CGPTvYd~~HiGhaR   56 (66)
                      -||.+|...||.|.-
T Consensus         3 sGpS~fgL~HLph~~   17 (64)
T PF13293_consen    3 SGPSLFGLNHLPHPS   17 (64)
T ss_pred             CCccccccccCCCCc
Confidence            389999999998854


No 135
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol. This multicomponent enzyme mediates electron transfer via a hydroxylase (MMOH), a coupling protein, and a reductase which is comprised of an N-terminal [2Fe-2S] ferredoxin domain, an FAD binding subdomain, and an NADH binding subdomain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. Dioxygenases add both atom of oxygen to the substrate, while mono-oxygenases add one atom to the substrate and one atom to water.
Probab=34.66  E-value=22  Score=23.59  Aligned_cols=10  Identities=40%  Similarity=0.999  Sum_probs=7.8

Q ss_pred             eeeeEEeCCc
Q 036777           36 KVGMYVCGVT   45 (66)
Q Consensus        36 ~v~~Y~CGPT   45 (66)
                      ...+|+|||.
T Consensus       201 ~~~vyicGp~  210 (236)
T cd06210         201 KPDIYLCGPP  210 (236)
T ss_pred             CcEEEEeCCH
Confidence            3468999995


No 136
>PRK14895 gltX glutamyl-tRNA synthetase; Provisional
Probab=34.61  E-value=2.5  Score=33.45  Aligned_cols=17  Identities=29%  Similarity=0.460  Sum_probs=13.6

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++=.+.||||+|++++
T Consensus        11 PSPTG~lHiG~artAL~   27 (513)
T PRK14895         11 PSPTGFLHIGSARTALF   27 (513)
T ss_pred             CCCCCCccHHHHHHHHH
Confidence            45567899999999764


No 137
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain.  Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains.  Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to for
Probab=34.44  E-value=25  Score=23.57  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=8.8

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       210 ~~~vyvcGp~~  220 (243)
T cd06216         210 DRQVYACGPPG  220 (243)
T ss_pred             cCeEEEECCHH
Confidence            46899999964


No 138
>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase. Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Gln to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. GlnRS contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-discriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme.
Probab=34.38  E-value=6.9  Score=28.05  Aligned_cols=18  Identities=28%  Similarity=0.412  Sum_probs=14.4

Q ss_pred             CCccCCCCCCCccceEEE
Q 036777           43 GVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~V~   60 (66)
                      -|++=.+.||||+|+++.
T Consensus         7 APsPtG~lHlG~~~~al~   24 (238)
T cd00807           7 PPEPNGYLHIGHAKAILL   24 (238)
T ss_pred             CCCCCCcccHHHHHHHHH
Confidence            367778899999998764


No 139
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide.  Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH.  Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal  FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via F
Probab=34.26  E-value=21  Score=25.24  Aligned_cols=10  Identities=40%  Similarity=0.803  Sum_probs=8.1

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||..
T Consensus       246 ~~vyiCGp~~  255 (289)
T cd06201         246 AQIMVCGSRA  255 (289)
T ss_pred             cEEEEECCHH
Confidence            4699999964


No 140
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed
Probab=34.21  E-value=2.5  Score=32.68  Aligned_cols=17  Identities=29%  Similarity=0.397  Sum_probs=13.2

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++=.+.||||+|++++
T Consensus        11 PSPtG~lHiG~~rtal~   27 (476)
T PRK01406         11 PSPTGYLHIGGARTALF   27 (476)
T ss_pred             CCCCCcccHHHHHHHHH
Confidence            45557899999998764


No 141
>PF02675 AdoMet_dc:  S-adenosylmethionine decarboxylase ;  InterPro: IPR003826 Polyamines such as spermidine and spermine are essential for cellular growth under most conditions, being implicated in a large number of cellular processes including DNA, RNA and protein synthesis. S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by generating the n-propylamine residue required for the synthesis of spermidine and spermine from putrescein [, ]. Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more common pyridoxal 5'-phosphate. These proteins can be divided into two main groups which show little sequence similarity either to each other, or to other pyruvoyl-dependent amino acid decarboxylases: class I enzymes found in bacteria and archaea, and class II enzymes found in eukaryotes. In both groups the active enzyme is generated by the post-translational autocatalytic cleavage of a precursor protein. This cleavage generates the pyruvate precursor from an internal serine residue and results in the formation of two non-identical subunits termed alpha and beta which form the active enzyme. Members of this family are related to the amino terminus of Escherichia coli S-adenosylmethionine decarboxylase.; GO: 0004014 adenosylmethionine decarboxylase activity, 0008295 spermidine biosynthetic process; PDB: 1VR7_A 3IWC_D 3IWD_D 3IWB_C 1TMI_A 1TLU_A 2III_A.
Probab=34.14  E-value=27  Score=21.36  Aligned_cols=9  Identities=33%  Similarity=0.995  Sum_probs=8.0

Q ss_pred             eeeeEEeCC
Q 036777           36 KVGMYVCGV   44 (66)
Q Consensus        36 ~v~~Y~CGP   44 (66)
                      .+++|+||+
T Consensus        71 avDiftC~~   79 (106)
T PF02675_consen   71 AVDIFTCGE   79 (106)
T ss_dssp             EEEEEEEST
T ss_pred             EEEEEEcCC
Confidence            489999998


No 142
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The hemoglobin domain adopts a globin fold with an embedded heme molecule. Flavohemoglobins also have a C-terminal reductase domain with bindiing sites for FAD and NAD(P)H. This domain catalyzes the conversion of NO + O2 + NAD(P)H to NO3- + NAD(P)+.  Instead of the oxygen transport function of hemoglobins, flavohemoglobins seem to act in NO dioxygenation and NO signalling.
Probab=34.05  E-value=27  Score=23.42  Aligned_cols=12  Identities=25%  Similarity=0.805  Sum_probs=9.3

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||..
T Consensus       208 ~~~~v~icGp~~  219 (247)
T cd06184         208 ADADFYLCGPVP  219 (247)
T ss_pred             CCCEEEEECCHH
Confidence            457899999963


No 143
>cd05829 Sortase_E Sortase E (SrtE) is a membrane transpeptidase found in gram-positive bacteria that cleaves surface proteins at a cell sorting motif and catalyzes a transpeptidation reaction in which the surface protein substrate is covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. The function of Sortase E is unknown. In two different sortase families, the N-terminus either functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring, or it contains a signal peptide only and the C-terminus serves as a membrane anchor. Most gram-positive bacteria contain more than one sortase and it is thought that the different sortases anchor different surface protein classes. The sortase domain is a modified beta-barrel flanked by two (SrtA) or three (SrtB) short alpha-helices.
Probab=33.21  E-value=96  Score=19.92  Aligned_cols=32  Identities=9%  Similarity=0.188  Sum_probs=21.2

Q ss_pred             eeecCCCeeeeEEeCCccCCCCCCCccceEEEE
Q 036777           29 FTPIVPGKVGMYVCGVTAYDLSHLGHARAAISF   61 (66)
Q Consensus        29 f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~   61 (66)
                      |.+..+..+.+.+|.|..-. ..-+...++|++
T Consensus       110 ~~~~~~~~LtLiTC~~~~~~-~~~~~~~r~vv~  141 (144)
T cd05829         110 YGDTGPPRLRLITCGGPFDR-RAGHYDDNVVVY  141 (144)
T ss_pred             ecCCCCCEEEEEEeCCCCCC-cCCcccccEEEE
Confidence            33445678999999976443 344566677664


No 144
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH.
Probab=32.37  E-value=31  Score=22.65  Aligned_cols=13  Identities=23%  Similarity=0.432  Sum_probs=9.9

Q ss_pred             CeeeeEEeCCccC
Q 036777           35 GKVGMYVCGVTAY   47 (66)
Q Consensus        35 ~~v~~Y~CGPTvY   47 (66)
                      +...+|+|||...
T Consensus       200 ~~~~~~icGp~~~  212 (234)
T cd06183         200 EDTLVLVCGPPPM  212 (234)
T ss_pred             CCeEEEEECCHHH
Confidence            4567999999754


No 145
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase. PA oxidoreductases of E. coli hydroxylate PA-CoA in the second step of PA degradation. Members of this group typically fuse a ferredoxin reductase-like domain with an iron-sulfur binding cluster domain. Ferredoxins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal portion may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and
Probab=32.28  E-value=29  Score=23.04  Aligned_cols=11  Identities=18%  Similarity=0.477  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||-.
T Consensus       206 ~~~v~icGp~~  216 (241)
T cd06214         206 FDEAFLCGPEP  216 (241)
T ss_pred             CcEEEEECCHH
Confidence            46799999953


No 146
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=31.88  E-value=1.7  Score=32.96  Aligned_cols=30  Identities=17%  Similarity=0.391  Sum_probs=18.4

Q ss_pred             eeeeEEeCCccCCCCCCCccceEEEEEeee
Q 036777           36 KVGMYVCGVTAYDLSHLGHARAAISFYILY   65 (66)
Q Consensus        36 ~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~   65 (66)
                      ..-+..+|.|+=..+||||+|-.+..|+++
T Consensus        23 ~~~v~~sG~sPSG~~HIGn~rEv~~~~~V~   52 (360)
T PF01921_consen   23 EPYVFASGISPSGLPHIGNFREVLRADMVA   52 (360)
T ss_dssp             SEEEEEEEE--SS---HHHHHHHHHHHHHH
T ss_pred             ccEEEecCCCCCCCcccccccchhhHHHHH
Confidence            455678899999999999999766555543


No 147
>PRK05713 hypothetical protein; Provisional
Probab=31.71  E-value=28  Score=24.70  Aligned_cols=13  Identities=23%  Similarity=0.406  Sum_probs=9.8

Q ss_pred             CeeeeEEeCCccC
Q 036777           35 GKVGMYVCGVTAY   47 (66)
Q Consensus        35 ~~v~~Y~CGPTvY   47 (66)
                      +...+|+|||...
T Consensus       273 ~~~~vyiCGp~~m  285 (312)
T PRK05713        273 RQTMALLCGSPAS  285 (312)
T ss_pred             CCeEEEEeCCHHH
Confidence            3467999999754


No 148
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced fe
Probab=31.36  E-value=28  Score=25.59  Aligned_cols=12  Identities=50%  Similarity=0.814  Sum_probs=9.1

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      +...+|+|||..
T Consensus       328 ~~~~vYvCG~~~  339 (382)
T cd06207         328 GAGVIYVCGSTW  339 (382)
T ss_pred             CCCEEEEECCcc
Confidence            334799999975


No 149
>cd02156 nt_trans nucleotidyl transferase superfamily. nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain.
Probab=31.04  E-value=17  Score=21.76  Aligned_cols=13  Identities=31%  Similarity=0.509  Sum_probs=10.1

Q ss_pred             CCccCCCCCCCccc
Q 036777           43 GVTAYDLSHLGHAR   56 (66)
Q Consensus        43 GPTvYd~~HiGhaR   56 (66)
                      |.+. |..|+||..
T Consensus         5 ~G~F-dp~H~GH~~   17 (105)
T cd02156           5 PGEP-GYLHIGHAK   17 (105)
T ss_pred             CCCC-CCCCHHHHH
Confidence            4555 999999964


No 150
>PLN02627 glutamyl-tRNA synthetase
Probab=30.78  E-value=3.1  Score=33.08  Aligned_cols=17  Identities=29%  Similarity=0.319  Sum_probs=13.8

Q ss_pred             CccCCCCCCCccceEEE
Q 036777           44 VTAYDLSHLGHARAAIS   60 (66)
Q Consensus        44 PTvYd~~HiGhaR~~V~   60 (66)
                      |++=.+.||||+|++++
T Consensus        52 PSPTG~LHiG~aRtAL~   68 (535)
T PLN02627         52 PSPTGNLHVGGARTALF   68 (535)
T ss_pred             CCCCCCccHHHHHHHHH
Confidence            56668899999999764


No 151
>cd06199 SiR Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain.
Probab=30.46  E-value=27  Score=25.56  Aligned_cols=9  Identities=44%  Similarity=1.010  Sum_probs=7.8

Q ss_pred             eeeEEeCCc
Q 036777           37 VGMYVCGVT   45 (66)
Q Consensus        37 v~~Y~CGPT   45 (66)
                      ..+|+|||.
T Consensus       308 ~~vYvCG~~  316 (360)
T cd06199         308 AHFYVCGDA  316 (360)
T ss_pred             CEEEEECCC
Confidence            569999996


No 152
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain. Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown. Many of these proteins are known to use CTP or ATP and release pyrophosphate.
Probab=30.41  E-value=15  Score=19.73  Aligned_cols=12  Identities=42%  Similarity=0.703  Sum_probs=9.7

Q ss_pred             ccCCCCCCCccc
Q 036777           45 TAYDLSHLGHAR   56 (66)
Q Consensus        45 TvYd~~HiGhaR   56 (66)
                      .-+|..|.||..
T Consensus         6 G~Fdp~H~GH~~   17 (66)
T TIGR00125         6 GTFDPFHLGHLD   17 (66)
T ss_pred             CccCCCCHHHHH
Confidence            458999999965


No 153
>KOG0436 consensus Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=30.29  E-value=3.3  Score=33.14  Aligned_cols=21  Identities=19%  Similarity=0.226  Sum_probs=17.8

Q ss_pred             cCCCCCCCccceEEEEEeeeC
Q 036777           46 AYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        46 vYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |-..+||||+-+.+..|.+.|
T Consensus        50 vNAaPHlGhlYS~llaDai~R   70 (578)
T KOG0436|consen   50 VNAAPHLGHLYSTLLADAIAR   70 (578)
T ss_pred             cCCCcchhHHHHHHHHHHHHH
Confidence            457899999999999998876


No 154
>PLN02859 glutamine-tRNA ligase
Probab=30.14  E-value=9.9  Score=31.74  Aligned_cols=20  Identities=25%  Similarity=0.315  Sum_probs=15.7

Q ss_pred             EeCCccCCCCCCCccceEEE
Q 036777           41 VCGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        41 ~CGPTvYd~~HiGhaR~~V~   60 (66)
                      ---|.+-.+.||||||+.++
T Consensus       268 RFaPsPtG~LHiGharaall  287 (788)
T PLN02859        268 RFPPEPNGYLHIGHAKAMFV  287 (788)
T ss_pred             EeCCCCCCcccHHHHHHHHH
Confidence            44577778899999998764


No 155
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional
Probab=29.71  E-value=35  Score=25.33  Aligned_cols=12  Identities=25%  Similarity=0.661  Sum_probs=9.2

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ....+|+|||..
T Consensus       372 ~~~~vyiCGP~~  383 (409)
T PRK05464        372 EDCEYYMCGPPM  383 (409)
T ss_pred             CCeEEEEECCHH
Confidence            346799999974


No 156
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed
Probab=29.44  E-value=28  Score=24.42  Aligned_cols=10  Identities=10%  Similarity=0.079  Sum_probs=8.0

Q ss_pred             eeEEeCCccC
Q 036777           38 GMYVCGVTAY   47 (66)
Q Consensus        38 ~~Y~CGPTvY   47 (66)
                      .+|+|||...
T Consensus       183 ~vy~CGP~~M  192 (281)
T PRK06222        183 RVVAIGPVIM  192 (281)
T ss_pred             EEEEECCHHH
Confidence            5899999743


No 157
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional
Probab=29.23  E-value=30  Score=25.08  Aligned_cols=11  Identities=27%  Similarity=0.812  Sum_probs=8.9

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       358 ~~~vyiCGp~~  368 (399)
T PRK13289        358 DADFYFCGPVP  368 (399)
T ss_pred             CCEEEEECCHH
Confidence            46799999974


No 158
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion]
Probab=29.11  E-value=4.7  Score=30.73  Aligned_cols=27  Identities=11%  Similarity=0.090  Sum_probs=18.6

Q ss_pred             EeeecCCCeeeeEEeCCccCCCCCCCc
Q 036777           28 LFTPIVPGKVGMYVCGVTAYDLSHLGH   54 (66)
Q Consensus        28 ~f~p~~~~~v~~Y~CGPTvYd~~HiGh   54 (66)
                      .++-.++...++|.|||.-|-..-+||
T Consensus       338 ~L~~~~~s~~DiY~~G~~~~M~~~~~~  364 (385)
T KOG3378|consen  338 DLEKLDLSECDIYMLGPNNYMRFVKQE  364 (385)
T ss_pred             HhhhcChhhCceeeeCcHHHHHHHHHH
Confidence            344456778999999998775544433


No 159
>PHA02451 hypothetical protein
Probab=29.06  E-value=22  Score=20.50  Aligned_cols=10  Identities=10%  Similarity=-0.114  Sum_probs=7.3

Q ss_pred             eEEeCCccCC
Q 036777           39 MYVCGVTAYD   48 (66)
Q Consensus        39 ~Y~CGPTvYd   48 (66)
                      =.+||||+--
T Consensus        20 dCvCgP~~e~   29 (54)
T PHA02451         20 DCPCDPELEL   29 (54)
T ss_pred             CcccCCccee
Confidence            3589999753


No 160
>PTZ00274 cytochrome b5 reductase; Provisional
Probab=28.81  E-value=31  Score=25.27  Aligned_cols=11  Identities=18%  Similarity=0.425  Sum_probs=8.7

Q ss_pred             eeeEEeCCccC
Q 036777           37 VGMYVCGVTAY   47 (66)
Q Consensus        37 v~~Y~CGPTvY   47 (66)
                      -.+|+|||...
T Consensus       264 ~~vylCGPp~M  274 (325)
T PTZ00274        264 KIIMLCGPDQL  274 (325)
T ss_pred             cEEEEeCCHHH
Confidence            46899999754


No 161
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit. This model represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=28.65  E-value=37  Score=25.14  Aligned_cols=11  Identities=27%  Similarity=0.800  Sum_probs=8.8

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       369 ~~~vylCGP~~  379 (405)
T TIGR01941       369 DCEFYMCGPPM  379 (405)
T ss_pred             CeEEEEeCCHH
Confidence            45799999974


No 162
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional
Probab=28.13  E-value=33  Score=24.53  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=8.6

Q ss_pred             eeeEEeCCccC
Q 036777           37 VGMYVCGVTAY   47 (66)
Q Consensus        37 v~~Y~CGPTvY   47 (66)
                      -.+|+|||...
T Consensus       204 ~~vyiCGP~~m  214 (332)
T PRK10684        204 RTVMTCGPAPY  214 (332)
T ss_pred             CEEEEECCHHH
Confidence            46899999753


No 163
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR). NADPH cytochrome p450 reductase serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a la
Probab=28.07  E-value=31  Score=25.36  Aligned_cols=11  Identities=36%  Similarity=0.736  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       328 ~~~vyiCGp~~  338 (384)
T cd06206         328 GARVYVCGDGR  338 (384)
T ss_pred             CcEEEEECCCc
Confidence            35699999974


No 164
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredo
Probab=28.07  E-value=33  Score=25.67  Aligned_cols=10  Identities=40%  Similarity=0.840  Sum_probs=8.3

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||..
T Consensus       364 ~~vYvCGp~~  373 (416)
T cd06204         364 AYIYVCGDAK  373 (416)
T ss_pred             CEEEEECCcc
Confidence            5699999975


No 165
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate. In MSR, electrons are transferred from NADPH to FAD to FMN to cob(II)alamin. MSR resembles proteins of the cytochrome p450 family including nitric oxide synthase, the alpha subunit of sulfite reductase, but contains an extended hinge region. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPORs resemble ferredoxin reductase (FNR) but have a connecting subdomain inserted within the flavin binding region, which helps orient the FMN binding doamin with the FNR module. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme
Probab=27.91  E-value=35  Score=25.38  Aligned_cols=10  Identities=40%  Similarity=0.976  Sum_probs=8.0

Q ss_pred             eeeeEEeCCc
Q 036777           36 KVGMYVCGVT   45 (66)
Q Consensus        36 ~v~~Y~CGPT   45 (66)
                      ...+|+|||.
T Consensus       345 ~~~iYvCG~~  354 (398)
T cd06203         345 NAKIYVCGDA  354 (398)
T ss_pred             CcEEEEECCc
Confidence            4679999984


No 166
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=27.90  E-value=33  Score=24.54  Aligned_cols=11  Identities=27%  Similarity=0.628  Sum_probs=8.6

Q ss_pred             eeeEEeCCccC
Q 036777           37 VGMYVCGVTAY   47 (66)
Q Consensus        37 v~~Y~CGPTvY   47 (66)
                      -.+|+|||...
T Consensus       208 ~~vyiCGp~~m  218 (352)
T TIGR02160       208 DEWFLCGPQAM  218 (352)
T ss_pred             CEEEEECCHHH
Confidence            46899999753


No 167
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD,
Probab=27.88  E-value=34  Score=23.35  Aligned_cols=10  Identities=10%  Similarity=-0.017  Sum_probs=8.0

Q ss_pred             eeEEeCCccC
Q 036777           38 GMYVCGVTAY   47 (66)
Q Consensus        38 ~~Y~CGPTvY   47 (66)
                      .+|+|||...
T Consensus       182 ~vyiCGP~~m  191 (248)
T cd06219         182 LVIAIGPPIM  191 (248)
T ss_pred             EEEEECCHHH
Confidence            5899999743


No 168
>TIGR03784 marine_sortase sortase, marine proteobacterial type. Members of this protein family are sortase enzymes, cysteine transpeptidases involved in protein sorting activities. Members of this family tend to be found in proteobacteria, rather than in Gram-positive bacteria where sortases attach proteins to the Gram-positive cell wall or participate in pilin cross-linking. Many species with this sortase appear to contain a signal target sequence, a protein with a Vault protein inter-alpha-trypsin domain (pfam08487) and a von Willebrand factor type A domain (pfam00092), encoded by an adjacent gene. These sortases are designated subfamily 6 according to Comfort and Clubb (2004).
Probab=27.73  E-value=1.3e+02  Score=20.27  Aligned_cols=29  Identities=14%  Similarity=0.182  Sum_probs=19.0

Q ss_pred             eecCCCeeeeEEeCCccCCCCCCCccceEEE
Q 036777           30 TPIVPGKVGMYVCGVTAYDLSHLGHARAAIS   60 (66)
Q Consensus        30 ~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~   60 (66)
                      .+.++..+.+.+|.|  +|..--+.-.+||+
T Consensus       144 ~~~~~~~LtLiTC~P--f~~~~~~~~~R~vV  172 (174)
T TIGR03784       144 LPADDSQLVLITCYP--FDALGSGGPLRYVV  172 (174)
T ss_pred             cCCCCCEEEEEeCCC--CCCCCCCCCcEEEE
Confidence            344456899999997  55543455566665


No 169
>PLN03115 ferredoxin--NADP(+) reductase; Provisional
Probab=27.66  E-value=38  Score=25.39  Aligned_cols=11  Identities=27%  Similarity=0.845  Sum_probs=8.7

Q ss_pred             CeeeeEEeCCc
Q 036777           35 GKVGMYVCGVT   45 (66)
Q Consensus        35 ~~v~~Y~CGPT   45 (66)
                      +...+|+|||.
T Consensus       318 ~~~~vYiCGp~  328 (367)
T PLN03115        318 DNTYVYMCGLK  328 (367)
T ss_pred             CCeEEEEeCCH
Confidence            34679999996


No 170
>COG1586 SpeD S-adenosylmethionine decarboxylase [Amino acid transport and metabolism]
Probab=27.25  E-value=31  Score=23.16  Aligned_cols=10  Identities=30%  Similarity=0.919  Sum_probs=8.4

Q ss_pred             eeeeEEeCCc
Q 036777           36 KVGMYVCGVT   45 (66)
Q Consensus        36 ~v~~Y~CGPT   45 (66)
                      .+++|+||..
T Consensus        87 ~iDVyTCG~~   96 (136)
T COG1586          87 TIDVYTCGDH   96 (136)
T ss_pred             EEEEEccCCC
Confidence            5899999983


No 171
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed
Probab=27.05  E-value=35  Score=23.23  Aligned_cols=9  Identities=33%  Similarity=0.933  Sum_probs=7.6

Q ss_pred             eeEEeCCcc
Q 036777           38 GMYVCGVTA   46 (66)
Q Consensus        38 ~~Y~CGPTv   46 (66)
                      .+|+|||..
T Consensus       183 ~vyvCGp~~  191 (250)
T PRK00054        183 AIYSCGPEI  191 (250)
T ss_pred             EEEEeCCHH
Confidence            689999964


No 172
>cd00004 Sortase Sortases are cysteine transpeptidases, found in gram-positive bacteria, that anchor surface proteins to peptidoglycans of the bacterial cell wall envelope. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. The different classes are called Sortase A or SrtA (subfamily 1), B or SrtB (subfamily 2), C or SrtC (subfamily3), D or SrtD (subfamilies 4 and 5), and E or SrtE. In two different sortase subfamilies, the N-terminus either functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring, or it contains a signal peptide only and the C-terminus serves as a membrane anchor. Most gram-positive bacteria contain more than one s
Probab=26.56  E-value=1.4e+02  Score=18.24  Aligned_cols=16  Identities=13%  Similarity=0.229  Sum_probs=12.4

Q ss_pred             eecCCCeeeeEEeCCc
Q 036777           30 TPIVPGKVGMYVCGVT   45 (66)
Q Consensus        30 ~p~~~~~v~~Y~CGPT   45 (66)
                      .+..+..+.+.+|+|.
T Consensus       100 ~~~~~~~LtLiTC~~~  115 (128)
T cd00004         100 PPTGDPILTLITCTPP  115 (128)
T ss_pred             cCCCCCEEEEEEcCCC
Confidence            3444578999999987


No 173
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=26.46  E-value=37  Score=23.18  Aligned_cols=11  Identities=27%  Similarity=0.582  Sum_probs=8.8

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||.-
T Consensus       180 ~~~vyiCGp~~  190 (246)
T cd06218         180 PDVVYACGPEP  190 (246)
T ss_pred             CCEEEEECCHH
Confidence            46899999964


No 174
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.
Probab=26.19  E-value=35  Score=23.40  Aligned_cols=11  Identities=27%  Similarity=0.459  Sum_probs=8.6

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||.-
T Consensus       190 ~~~vyicGp~~  200 (253)
T cd06221         190 NTVAIVCGPPI  200 (253)
T ss_pred             CcEEEEECCHH
Confidence            45699999964


No 175
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=26.13  E-value=38  Score=22.75  Aligned_cols=10  Identities=40%  Similarity=0.889  Sum_probs=7.9

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      -.+|+|||.-
T Consensus       168 ~~vyicGp~~  177 (233)
T cd06220         168 DAIYVCGPEI  177 (233)
T ss_pred             CEEEEECCHH
Confidence            3689999964


No 176
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional
Probab=25.79  E-value=42  Score=23.63  Aligned_cols=12  Identities=17%  Similarity=0.371  Sum_probs=9.0

Q ss_pred             eeeeEEeCCccC
Q 036777           36 KVGMYVCGVTAY   47 (66)
Q Consensus        36 ~v~~Y~CGPTvY   47 (66)
                      ...+|+|||...
T Consensus       212 ~~~vyiCGP~~m  223 (289)
T PRK08345        212 NTYAAICGPPVM  223 (289)
T ss_pred             ccEEEEECCHHH
Confidence            346999999743


No 177
>KOG0433 consensus Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=25.68  E-value=4.3  Score=34.27  Aligned_cols=21  Identities=38%  Similarity=0.305  Sum_probs=18.4

Q ss_pred             cCCCCCCCccceEEEEEeeeC
Q 036777           46 AYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        46 vYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .-...|||||+..|.+|++.|
T Consensus        66 anG~lhlghalnkILkdIinr   86 (937)
T KOG0433|consen   66 ANGNLHLGHALNKILKDIINR   86 (937)
T ss_pred             cCCCccchHHHHHHHHHHHHH
Confidence            667899999999999998765


No 178
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated
Probab=25.54  E-value=39  Score=24.04  Aligned_cols=11  Identities=27%  Similarity=0.688  Sum_probs=8.7

Q ss_pred             eeeeEEeCCcc
Q 036777           36 KVGMYVCGVTA   46 (66)
Q Consensus        36 ~v~~Y~CGPTv   46 (66)
                      ...+|+|||..
T Consensus       298 ~~~vy~CGp~~  308 (339)
T PRK07609        298 GHQVYACGSPV  308 (339)
T ss_pred             CCEEEEECCHH
Confidence            35799999964


No 179
>PRK11872 antC anthranilate dioxygenase reductase; Provisional
Probab=25.37  E-value=39  Score=24.39  Aligned_cols=10  Identities=40%  Similarity=1.026  Sum_probs=8.0

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||.-
T Consensus       302 ~~vy~CGp~~  311 (340)
T PRK11872        302 FDMYLCGPPP  311 (340)
T ss_pred             CEEEEeCCHH
Confidence            4699999963


No 180
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (formi
Probab=25.15  E-value=41  Score=22.65  Aligned_cols=10  Identities=20%  Similarity=0.222  Sum_probs=8.1

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||.-
T Consensus       179 ~~v~icGp~~  188 (243)
T cd06192         179 DRIIVAGSDI  188 (243)
T ss_pred             CEEEEECCHH
Confidence            4699999963


No 181
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=25.06  E-value=19  Score=25.17  Aligned_cols=13  Identities=23%  Similarity=0.363  Sum_probs=10.4

Q ss_pred             eeeEEeCCccCCC
Q 036777           37 VGMYVCGVTAYDL   49 (66)
Q Consensus        37 v~~Y~CGPTvYd~   49 (66)
                      +-+|+|||.+|-.
T Consensus        19 ~a~yivGP~LYWh   31 (176)
T PF06364_consen   19 LAGYIVGPPLYWH   31 (176)
T ss_pred             HHhheeCchHHHH
Confidence            3579999999854


No 182
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hy
Probab=24.92  E-value=47  Score=22.41  Aligned_cols=12  Identities=17%  Similarity=0.415  Sum_probs=9.4

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      +...+|+|||.-
T Consensus       197 ~~~~vyicGp~~  208 (235)
T cd06193         197 GDGYVWIAGEAG  208 (235)
T ss_pred             CCeEEEEEccHH
Confidence            446899999964


No 183
>cd08064 MPN_eIF3f Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in eIF3f. Eukaryotic translation initiation factor 3 (eIF3) subunit F (eIF3F; EIF3S5; eIF3-p47; eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; Mov34/MPN/PAD-1 family protein) is an evolutionarily non-conserved subunit of the functional core that comprises eIF3a, eIF3b, eIF3c, eIF3e, eIF3f, and eIF3h, and contains the MPN domain. However, it lacks the canonical JAMM motif, and therefore does not show catalytic isopeptidase activity. It has been shown that eIF3f mRNA expression is significantly decreased in many human tumors including pancreatic cancer and melanoma. EIF3f is a potent inhibitor of HIV-1 replication; it mediates restriction of HIV-1 expression through several factors including the serine/arginine-rich (SR) protein 9G8, and cyclin-dependent kinase 11 (CDK11). EIF3f phosphorylation by CDK11 is important in regulating its function in translation and ap
Probab=24.44  E-value=55  Score=23.14  Aligned_cols=14  Identities=29%  Similarity=0.318  Sum_probs=11.6

Q ss_pred             CCeeeeEEeCCccC
Q 036777           34 PGKVGMYVCGVTAY   47 (66)
Q Consensus        34 ~~~v~~Y~CGPTvY   47 (66)
                      ...|+||..||.+.
T Consensus        76 ~~vVGWY~tg~~~~   89 (265)
T cd08064          76 EVIVGWYATGSEIT   89 (265)
T ss_pred             CcEEeeeeCCCCCC
Confidence            36799999999765


No 184
>cd05828 Sortase_D_4 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-4. These sortases recognize a unique sorting signal (LPXTA) and they constitute a specialized sorting pathway found in bacilli. Their substrates are predicted to be predominantly enzymes such as 5'-nucleotidases, glycosyl hydrolase, and subtilase.
Probab=23.73  E-value=1.8e+02  Score=18.00  Aligned_cols=19  Identities=11%  Similarity=0.205  Sum_probs=13.9

Q ss_pred             EEeeecCCCeeeeEEeCCc
Q 036777           27 ELFTPIVPGKVGMYVCGVT   45 (66)
Q Consensus        27 e~f~p~~~~~v~~Y~CGPT   45 (66)
                      +.+.+..+..+.+.+|.|.
T Consensus        93 ~~~~~~~~~~LtLiTC~p~  111 (127)
T cd05828          93 SVLAPSDDPTLTLITCYPF  111 (127)
T ss_pred             EEccCCCCCEEEEEeCCCC
Confidence            3444545678999999974


No 185
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]
Probab=23.58  E-value=1.1e+02  Score=23.13  Aligned_cols=27  Identities=7%  Similarity=0.127  Sum_probs=19.5

Q ss_pred             ccccccccCCCcceEEEeCCCCceEEee
Q 036777            3 TSKETTAAAPKMDLIIYNSMTQQKELFT   30 (66)
Q Consensus         3 ~~~~~~~~~~~~~l~lyntltr~ke~f~   30 (66)
                      .+|-.+..+. .+|+|||+++..|-...
T Consensus       117 n~qivSGSrD-kTiklwnt~g~ck~t~~  143 (315)
T KOG0279|consen  117 NRQIVSGSRD-KTIKLWNTLGVCKYTIH  143 (315)
T ss_pred             CceeecCCCc-ceeeeeeecccEEEEEe
Confidence            4556666666 56999999998876543


No 186
>PLN02406 ethanolamine-phosphate cytidylyltransferase
Probab=23.39  E-value=35  Score=26.48  Aligned_cols=23  Identities=39%  Similarity=0.637  Sum_probs=18.8

Q ss_pred             CCCeeeeEEeCCccCCCCCCCccce
Q 036777           33 VPGKVGMYVCGVTAYDLSHLGHARA   57 (66)
Q Consensus        33 ~~~~v~~Y~CGPTvYd~~HiGhaR~   57 (66)
                      .++.-.+|++|  .+|..|.||.+.
T Consensus       248 ~~~~~iVyv~G--~FDlfH~GHi~~  270 (418)
T PLN02406        248 GPDARIVYIDG--AFDLFHAGHVEI  270 (418)
T ss_pred             CCCCeEEEECC--eeccCCHHHHHH
Confidence            35677899997  699999999863


No 187
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion]
Probab=23.07  E-value=43  Score=23.91  Aligned_cols=11  Identities=27%  Similarity=0.878  Sum_probs=9.2

Q ss_pred             eeeEEeCCccC
Q 036777           37 VGMYVCGVTAY   47 (66)
Q Consensus        37 v~~Y~CGPTvY   47 (66)
                      -.+|+|||.-+
T Consensus       197 r~~y~CGp~~f  207 (266)
T COG1018         197 REVYLCGPGPF  207 (266)
T ss_pred             CEEEEECCHHH
Confidence            78999999754


No 188
>PRK08221 anaerobic sulfite reductase subunit B; Provisional
Probab=21.88  E-value=62  Score=22.44  Aligned_cols=13  Identities=15%  Similarity=0.250  Sum_probs=9.7

Q ss_pred             CeeeeEEeCCccC
Q 036777           35 GKVGMYVCGVTAY   47 (66)
Q Consensus        35 ~~v~~Y~CGPTvY   47 (66)
                      ....+|+|||.-.
T Consensus       191 ~~~~vylCGp~~m  203 (263)
T PRK08221        191 DNMQVIVVGPPIM  203 (263)
T ss_pred             CCeEEEEECCHHH
Confidence            3467999999743


No 189
>PF01234 NNMT_PNMT_TEMT:  NNMT/PNMT/TEMT family;  InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. Several cytoplasmic vertebrate methyltransferases are evolutionary related [], including nicotinamide N-methyltransferase (2.1.1.1 from EC) (NNMT); phenylethanolamine N-methyltransferase (2.1.1.28 from EC) (PNMT); and thioether S-methyltransferase (2.1.1.96 from EC) (TEMT). NNMT catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for the biotransformation of many drugs and xenobiotic compounds. PNMT catalyzes the last step in catecholamine biosynthesis, the conversion of noradrenalin to adrenalin; and TEMT catalyzes the methylation of dimethyl sulphide into trimethylsulphonium. These three enzymes use S-adenosyl-L-methionine as the methyl donor. They are proteins of 30 to 32 kDa.; GO: 0008168 methyltransferase activity; PDB: 2IIP_C 3ROD_A 2OBF_A 3HCA_B 2ONY_B 3KR1_A 2OPB_B 3KQP_B 2AN4_B 3KQM_A ....
Probab=21.83  E-value=60  Score=23.38  Aligned_cols=25  Identities=16%  Similarity=0.004  Sum_probs=15.1

Q ss_pred             EEeCCccCCCCCC-CccceEEEEEee
Q 036777           40 YVCGVTAYDLSHL-GHARAAISFYIL   64 (66)
Q Consensus        40 Y~CGPTvYd~~Hi-GhaR~~V~~Dvl   64 (66)
                      ..||||+|...=. -+++..+..|..
T Consensus        63 iGsGPtiy~~lsa~~~f~~I~l~dy~   88 (256)
T PF01234_consen   63 IGSGPTIYQLLSACEWFEEIVLSDYS   88 (256)
T ss_dssp             ES-TT--GGGTTGGGTEEEEEEEESS
T ss_pred             eCCCcHHHhhhhHHHhhcceEEeecc
Confidence            5799999965444 667777777754


No 190
>PF07865 DUF1652:  Protein of unknown function (DUF1652);  InterPro: IPR012448  The proteins in this entry have not been characterised.
Probab=21.77  E-value=1.2e+02  Score=17.81  Aligned_cols=23  Identities=17%  Similarity=0.284  Sum_probs=17.9

Q ss_pred             cccCCCcceEEEeCCCCceEEee
Q 036777            8 TAAAPKMDLIIYNSMTQQKELFT   30 (66)
Q Consensus         8 ~~~~~~~~l~lyntltr~ke~f~   30 (66)
                      .+++..|+++|||-.|++.+-..
T Consensus        21 ~~~~~smtvrl~d~~sg~~~l~v   43 (69)
T PF07865_consen   21 IAPDGSMTVRLFDPASGRVELTV   43 (69)
T ss_pred             ECCCCcEEEEEecCCCCcEEEEE
Confidence            45666799999999999876554


No 191
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein. Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB.
Probab=21.10  E-value=53  Score=24.72  Aligned_cols=10  Identities=30%  Similarity=0.996  Sum_probs=8.2

Q ss_pred             eeeEEeCCcc
Q 036777           37 VGMYVCGVTA   46 (66)
Q Consensus        37 v~~Y~CGPTv   46 (66)
                      ..+|+|||..
T Consensus       364 ~~vYiCGp~~  373 (411)
T TIGR03224       364 TYIYICGLKG  373 (411)
T ss_pred             cEEEEECCHH
Confidence            5699999974


No 192
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=21.08  E-value=20  Score=29.54  Aligned_cols=16  Identities=38%  Similarity=0.505  Sum_probs=13.0

Q ss_pred             CCccCCCCCCCccceE
Q 036777           43 GVTAYDLSHLGHARAA   58 (66)
Q Consensus        43 GPTvYd~~HiGhaR~~   58 (66)
                      -|-.-.+.|||||+..
T Consensus       206 PPEpSGyLHIGHAKAA  221 (712)
T KOG1147|consen  206 PPEPSGYLHIGHAKAA  221 (712)
T ss_pred             CCCCCceeehhhHHHH
Confidence            5677788999999864


No 193
>TIGR03094 sulfo_cyanin sulfocyanin. Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus. The most closely related proteins characterized as functionally different are the rustacyanins.
Probab=20.74  E-value=77  Score=22.50  Aligned_cols=30  Identities=23%  Similarity=0.402  Sum_probs=17.4

Q ss_pred             eEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEe
Q 036777           26 KELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYI   63 (66)
Q Consensus        26 ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dv   63 (66)
                      ...|.+.. ...-||+||.+       |||-.=.+-++
T Consensus       153 sg~~~~~~-~G~YwlvCgip-------GHAesGMw~~l  182 (195)
T TIGR03094       153 SGWWNDTS-AGKYWLVCGIT-------GHAESGMWAVV  182 (195)
T ss_pred             EEEeccCC-CeeEEEEcccC-------ChhhcCcEEEE
Confidence            34444443 45679999975       55555444443


No 194
>PF10477 EIF4E-T:  Nucleocytoplasmic shuttling protein for mRNA cap-binding EIF4E;  InterPro: IPR018862  EIF4E-T is the transporter protein for shuttling the mRNA cap-binding protein EIF4E protein, targeting it for nuclear import. EIF4E-T contains several key binding domains including two functional leucine-rich NESs (nuclear export signals) between residues 438-447 and 613-638 in the human protein. The other two binding domains are an EIF4E-binding site, between residues 27-42 in Q9EST3 from SWISSPROT, and a bipartite NLS (nuclear localisation signals) between 194-211, and these lie in family EIF4E-T_N. EIF4E is the eukaryotic translation initiation factor 4E that is the rate-limiting factor for cap-dependent translation initiation []. 
Probab=20.50  E-value=39  Score=27.02  Aligned_cols=12  Identities=17%  Similarity=0.274  Sum_probs=10.1

Q ss_pred             CeeeeEEeCCcc
Q 036777           35 GKVGMYVCGVTA   46 (66)
Q Consensus        35 ~~v~~Y~CGPTv   46 (66)
                      ...-|+.||||=
T Consensus       200 eEPEWfS~GPTS  211 (578)
T PF10477_consen  200 EEPEWFSAGPTS  211 (578)
T ss_pred             cCccccccCCCc
Confidence            456899999995


No 195
>COG4198 Uncharacterized conserved protein [Function unknown]
Probab=20.50  E-value=55  Score=25.50  Aligned_cols=22  Identities=45%  Similarity=0.682  Sum_probs=18.0

Q ss_pred             ceEEeeecCCCeeeeEEeCCccC
Q 036777           25 QKELFTPIVPGKVGMYVCGVTAY   47 (66)
Q Consensus        25 ~ke~f~p~~~~~v~~Y~CGPTvY   47 (66)
                      .||++.|.++.+++||+-| .-|
T Consensus       278 ~k~~~~p~~~he~~my~~g-kwY  299 (405)
T COG4198         278 YKEPAKPSKPHEIGMYVDG-KWY  299 (405)
T ss_pred             ecccCCCCCccceeEEEcC-EEE
Confidence            3789999999999999988 444


No 196
>PRK06214 sulfite reductase; Provisional
Probab=20.26  E-value=56  Score=25.83  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=8.1

Q ss_pred             eeeeEEeCCc
Q 036777           36 KVGMYVCGVT   45 (66)
Q Consensus        36 ~v~~Y~CGPT   45 (66)
                      ...+|+|||.
T Consensus       477 ~a~iYVCGp~  486 (530)
T PRK06214        477 GAHFYVCGDA  486 (530)
T ss_pred             CcEEEEeCCh
Confidence            4579999995


No 197
>PF01467 CTP_transf_2:  Cytidylyltransferase;  InterPro: IPR004820 This family includes []:  Cholinephosphate cytidyltransferase (P49585 from SWISSPROT). Glycerol-3-phosphate cytidyltransferase (P27623 from SWISSPROT).  CTP:cholinephosphate cytidylyltransferase (CCT) is a key regulatory enzyme in phosphatidylcholine biosynthesis that catalyzes the formation of CDP-choline. A comparison of the catalytic domains of CCTs from a wide variety of organisms reveals a large number of completely conserved residues. There may be a role for the conserved HXGH sequence in catalysis. The membrane-binding domain in rat CCT has been defined, and it has been suggested that lipids may play a role in inactivating the enzyme. A phosphorylation domain has been described [].; GO: 0016779 nucleotidyltransferase activity, 0009058 biosynthetic process; PDB: 1O6B_A 1H1T_A 1B6T_A 1GN8_A 1QJC_A 3ELB_A 3NBK_A 3NBA_A 1TFU_A 3LCJ_A ....
Probab=20.24  E-value=24  Score=21.21  Aligned_cols=11  Identities=36%  Similarity=0.718  Sum_probs=5.7

Q ss_pred             cCCCCCCCccc
Q 036777           46 AYDLSHLGHAR   56 (66)
Q Consensus        46 vYd~~HiGhaR   56 (66)
                      -+|+.|.||..
T Consensus         5 sFdP~H~GH~~   15 (157)
T PF01467_consen    5 SFDPPHNGHLN   15 (157)
T ss_dssp             --TT--HHHHH
T ss_pred             EcCcccHHHHH
Confidence            57899999964


Done!