BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036782
         (166 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3S6K|A Chain A, Crystal Structure Of Xcnags
          Length = 467

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 32  PHKFAIVHKVFGASNVSKMLQELPVH-QRADAVSSLVYEANARVRDPVYGCVGAI 85
           PH  AIV KVF ASN+ K+++ L  +  RA +++  V+EA    RD  YG VG +
Sbjct: 126 PHALAIVRKVFQASNL-KLVEALQQNGARATSITGGVFEAEYLNRD-TYGLVGEV 178


>pdb|3NQB|A Chain A, Crystal Structure Of Adenine Deaminase From Agrobacterium
           Tumefaciens (Str. C 58)
 pdb|3NQB|B Chain B, Crystal Structure Of Adenine Deaminase From Agrobacterium
           Tumefaciens (Str. C 58)
 pdb|3T81|A Chain A, Crystal Structure Of Diiron Adenine Deaminase
 pdb|3T81|B Chain B, Crystal Structure Of Diiron Adenine Deaminase
 pdb|3T8L|A Chain A, Crystal Structure Of Adenine Deaminase With MnFE
 pdb|3T8L|B Chain B, Crystal Structure Of Adenine Deaminase With MnFE
          Length = 608

 Score = 27.7 bits (60), Expect = 3.1,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 31  DPHKFAIVHKVFGASNVSKMLQELPV 56
           DPH+F  VH V G    +K ++ LP+
Sbjct: 123 DPHEFGNVHGVDGVRWAAKAIENLPL 148


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,311,195
Number of Sequences: 62578
Number of extensions: 137560
Number of successful extensions: 231
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 230
Number of HSP's gapped (non-prelim): 2
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)