Query         036790
Match_columns 121
No_of_seqs    69 out of 71
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:31:38 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036790.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036790hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4206 Spliceosomal protein s  85.8     0.2 4.3E-06   41.2  -0.5   43   17-65     96-138 (221)
  2 PRK10963 hypothetical protein;  47.8      23 0.00049   28.0   3.2   31   36-66      6-36  (223)
  3 PF13276 HTH_21:  HTH-like doma  40.5      58  0.0013   20.1   3.7   29   37-65     25-56  (60)
  4 COG4445 MiaE Hydroxylase for s  38.4      30 0.00064   28.4   2.6   36   26-62     53-88  (203)
  5 PF12921 ATP13:  Mitochondrial   35.6   1E+02  0.0022   22.5   4.8   36   29-64     49-87  (126)
  6 KOG1924 RhoA GTPase effector D  35.1      90  0.0019   31.1   5.6   12   57-68    510-521 (1102)
  7 COG4608 AppF ABC-type oligopep  35.0      25 0.00053   29.7   1.7   24   36-59    118-155 (268)
  8 PF04340 DUF484:  Protein of un  34.7      13 0.00028   28.9   0.0   29   36-64      9-37  (225)
  9 PF07508 Recombinase:  Recombin  34.2      91   0.002   20.4   4.0   36   32-68      4-39  (102)
 10 cd07910 MiaE MiaE tRNA-modifyi  33.8      40 0.00086   27.1   2.6   20   48-69     64-83  (180)
 11 PF05009 EBV-NA3:  Epstein-Barr  33.6      14  0.0003   31.3   0.0   11  107-117   222-232 (255)
 12 PF07708 Tash_PEST:  Tash prote  31.6      22 0.00047   19.5   0.5    9  110-118    10-18  (19)
 13 KOG3555 Ca2+-binding proteogly  31.4      25 0.00054   31.7   1.2   17  103-119   404-420 (434)
 14 COG5406 Nucleosome binding fac  28.7      28 0.00061   33.9   1.1   16  104-119   964-979 (1001)
 15 cd02651 nuc_hydro_IU_UC_XIUA n  27.7      43 0.00094   27.1   1.9   18   35-52    124-141 (302)
 16 PHA02543 regA translation repr  25.4      49  0.0011   25.5   1.7   28   32-60     19-46  (125)
 17 cd02654 nuc_hydro_CjNH nuc_hyd  24.0      54  0.0012   27.1   1.8   18   35-52    139-156 (318)
 18 COG5644 Uncharacterized conser  22.9      41  0.0009   32.3   1.1   14  105-118   168-181 (869)
 19 smart00313 PXA Domain associat  22.7 1.2E+02  0.0026   22.8   3.4   18   41-58    156-174 (176)
 20 PF07802 GCK:  GCK domain;  Int  22.7 1.5E+02  0.0032   20.7   3.6   27   33-59     42-68  (76)
 21 PRK10768 ribonucleoside hydrol  22.3      60  0.0013   26.5   1.8   18   35-52    126-143 (304)
 22 PF04931 DNA_pol_phi:  DNA poly  22.0      50  0.0011   30.6   1.4   16   32-47    587-602 (784)
 23 PF12056 DUF3537:  Protein of u  21.9      62  0.0013   29.0   1.9   16  105-120   332-347 (398)
 24 cd02653 nuc_hydro_3 NH_3: A su  21.7      64  0.0014   26.8   1.9   18   35-52    123-140 (320)
 25 KOG0819 Annexin [Intracellular  21.7      96  0.0021   27.0   3.0   29   32-60    235-264 (321)
 26 cd02649 nuc_hydro_CeIAG nuc_hy  21.3      71  0.0015   26.4   2.1   19   35-53    127-145 (306)
 27 PRK10443 rihA ribonucleoside h  21.0      75  0.0016   26.2   2.1   18   35-52    127-144 (311)
 28 PF01832 Glucosaminidase:  Mann  20.7      60  0.0013   22.7   1.3   19   43-61    118-136 (136)
 29 COG3159 Uncharacterized protei  20.7 1.2E+02  0.0026   25.2   3.2   28   37-64      8-35  (218)
 30 KOG2925 Predicted translation   20.6      63  0.0014   25.9   1.6   20   48-67     90-109 (167)
 31 PF13812 PPR_3:  Pentatricopept  20.3      91   0.002   16.1   1.7   14   50-63     21-34  (34)

No 1  
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]
Probab=85.76  E-value=0.2  Score=41.23  Aligned_cols=43  Identities=33%  Similarity=0.529  Sum_probs=38.7

Q ss_pred             cCCCCCccccCCCCCHHHHHHHHHHHHhCChhHHHHHHHHHhcCCCCCC
Q 036790           17 YPFPPHLEYAYPPVDGNILTNIVNALIAVPRFYTQVLHLMNKMNIPAPF   65 (121)
Q Consensus        17 ~p~pp~L~Y~YPpp~~~il~nI~~~L~~~p~FY~QVLHLMNkmnLppPF   65 (121)
                      .+.. .+.|+|++-+.+++.+|..-+..+..||.     ||+||+|+||
T Consensus        96 ~~~~-~~v~~~~k~~~~~~~~~~~~~~~ng~~~~-----~~~~~~p~p~  138 (221)
T KOG4206|consen   96 QAPG-TFVEKEKKINGEILARIKQPLDTNGHFYN-----MNRMNLPPPF  138 (221)
T ss_pred             ccCc-eeccccCccccccccccCCcccccccccc-----cccccCCCCc
Confidence            3344 78889999999999999999999999999     9999999999


No 2  
>PRK10963 hypothetical protein; Provisional
Probab=47.75  E-value=23  Score=27.96  Aligned_cols=31  Identities=29%  Similarity=0.675  Sum_probs=27.6

Q ss_pred             HHHHHHHHhCChhHHHHHHHHHhcCCCCCCC
Q 036790           36 TNIVNALIAVPRFYTQVLHLMNKMNIPAPFR   66 (121)
Q Consensus        36 ~nI~~~L~~~p~FY~QVLHLMNkmnLppPF~   66 (121)
                      ..|+.-|..||+|+.+=-.||.+|.+|-|-+
T Consensus         6 ~~V~~yL~~~PdFf~~h~~Ll~~L~lph~~~   36 (223)
T PRK10963          6 RAVVDYLLQNPDFFIRNARLVEQMRVPHPVR   36 (223)
T ss_pred             HHHHHHHHHCchHHhhCHHHHHhccCCCCCC
Confidence            4688999999999999999999999997743


No 3  
>PF13276 HTH_21:  HTH-like domain
Probab=40.53  E-value=58  Score=20.10  Aligned_cols=29  Identities=21%  Similarity=0.165  Sum_probs=19.6

Q ss_pred             HHHHHHHhCChh---HHHHHHHHHhcCCCCCC
Q 036790           37 NIVNALIAVPRF---YTQVLHLMNKMNIPAPF   65 (121)
Q Consensus        37 nI~~~L~~~p~F---Y~QVLHLMNkmnLppPF   65 (121)
                      .|...|...-.|   -..|..||++|||-+..
T Consensus        25 ri~~~L~~~~~~~v~~krV~RlM~~~gL~~~~   56 (60)
T PF13276_consen   25 RIWAELRREGGIRVSRKRVRRLMREMGLRSKR   56 (60)
T ss_pred             HHHHHHhccCcccccHHHHHHHHHHcCCcccC
Confidence            344555554333   46789999999997764


No 4  
>COG4445 MiaE Hydroxylase for synthesis of 2-methylthio-cis-ribozeatin in tRNA [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis]
Probab=38.44  E-value=30  Score=28.41  Aligned_cols=36  Identities=25%  Similarity=0.497  Sum_probs=21.4

Q ss_pred             cCCCCCHHHHHHHHHHHHhCChhHHHHHHHHHhcCCC
Q 036790           26 AYPPVDGNILTNIVNALIAVPRFYTQVLHLMNKMNIP   62 (121)
Q Consensus        26 ~YPpp~~~il~nI~~~L~~~p~FY~QVLHLMNkmnLp   62 (121)
                      +|+. +...+...+.-..-.=.-|.||+.+|.+.|+|
T Consensus        53 kY~~-~~~lv~km~~larEEL~HFeqV~eilq~RnI~   88 (203)
T COG4445          53 KYPS-NTDLVDKMVLLAREELHHFEQVLEILQARNIP   88 (203)
T ss_pred             Hccc-hHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCc
Confidence            3443 34444443322222334578999999999996


No 5  
>PF12921 ATP13:  Mitochondrial ATPase expression;  InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase. The protein has a basic amino terminal signal sequence that is cleaved upon import into mitochondria [].
Probab=35.64  E-value=1e+02  Score=22.46  Aligned_cols=36  Identities=19%  Similarity=0.271  Sum_probs=27.8

Q ss_pred             CCCHHHHHHHHHHHHhCChhHHHH---HHHHHhcCCCCC
Q 036790           29 PVDGNILTNIVNALIAVPRFYTQV---LHLMNKMNIPAP   64 (121)
Q Consensus        29 pp~~~il~nI~~~L~~~p~FY~QV---LHLMNkmnLppP   64 (121)
                      -||..+|..|++++..+-.|..=+   =|.+++-+++-|
T Consensus        49 ~Pt~~lL~AIv~sf~~n~~i~~al~~vd~fs~~Y~I~i~   87 (126)
T PF12921_consen   49 YPTSRLLIAIVHSFGYNGDIFSALKLVDFFSRKYPIPIP   87 (126)
T ss_pred             CCCHHHHHHHHHHHHhcccHHHHHHHHHHHHHHcCCCCC
Confidence            389999999999999999988654   456666665544


No 6  
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]
Probab=35.14  E-value=90  Score=31.12  Aligned_cols=12  Identities=17%  Similarity=0.418  Sum_probs=9.0

Q ss_pred             HhcCCCCCCCCC
Q 036790           57 NKMNIPAPFRMA   68 (121)
Q Consensus        57 NkmnLppPF~~~   68 (121)
                      +||+|..|++..
T Consensus       510 e~~al~s~~~~~  521 (1102)
T KOG1924|consen  510 EKQALSSPSQLL  521 (1102)
T ss_pred             hhhhccCcccCC
Confidence            677888888755


No 7  
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=34.97  E-value=25  Score=29.65  Aligned_cols=24  Identities=29%  Similarity=0.563  Sum_probs=20.3

Q ss_pred             HHHHHHHHhCChhH--------------HHHHHHHHhc
Q 036790           36 TNIVNALIAVPRFY--------------TQVLHLMNKM   59 (121)
Q Consensus        36 ~nI~~~L~~~p~FY--------------~QVLHLMNkm   59 (121)
                      -.||+||+-+|+|.              .|||+||.++
T Consensus       118 i~IARALal~P~liV~DEpvSaLDvSiqaqIlnLL~dl  155 (268)
T COG4608         118 IGIARALALNPKLIVADEPVSALDVSVQAQILNLLKDL  155 (268)
T ss_pred             HHHHHHHhhCCcEEEecCchhhcchhHHHHHHHHHHHH
Confidence            36899999999997              5999999765


No 8  
>PF04340 DUF484:  Protein of unknown function, DUF484;  InterPro: IPR007435 This family consists of several proteins of uncharacterised function.; PDB: 3E98_B.
Probab=34.69  E-value=13  Score=28.88  Aligned_cols=29  Identities=21%  Similarity=0.542  Sum_probs=0.0

Q ss_pred             HHHHHHHHhCChhHHHHHHHHHhcCCCCC
Q 036790           36 TNIVNALIAVPRFYTQVLHLMNKMNIPAP   64 (121)
Q Consensus        36 ~nI~~~L~~~p~FY~QVLHLMNkmnLppP   64 (121)
                      ..|+.-|..||+|+.+=-.||..|.+|-|
T Consensus         9 ~~V~~yL~~~PdFf~~~~~ll~~l~~ph~   37 (225)
T PF04340_consen    9 EDVAAYLRQHPDFFERHPELLAELRLPHP   37 (225)
T ss_dssp             -----------------------------
T ss_pred             HHHHHHHHhCcHHHHhCHHHHHHcCCCCC
Confidence            46888999999999999999999999876


No 9  
>PF07508 Recombinase:  Recombinase;  InterPro: IPR011109 This domain is usually found associated with IPR006119 from INTERPRO in putative integrases/recombinases of mobile genetic elements of diverse bacteria and phages.
Probab=34.24  E-value=91  Score=20.37  Aligned_cols=36  Identities=17%  Similarity=0.264  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHhCChhHHHHHHHHHhcCCCCCCCCC
Q 036790           32 GNILTNIVNALIAVPRFYTQVLHLMNKMNIPAPFRMA   68 (121)
Q Consensus        32 ~~il~nI~~~L~~~p~FY~QVLHLMNkmnLppPF~~~   68 (121)
                      ..|+..|...++ .-.=++||.+.+|..+++.|-+..
T Consensus         4 a~vVr~if~~~~-~g~s~~~I~~~ln~~gi~~~~~~~   39 (102)
T PF07508_consen    4 AEVVREIFELYL-EGYSLRQIARELNEKGIPTPRGKK   39 (102)
T ss_pred             HHHHHHHHHHHH-cCCCHHHHHHHHHhcCCccccCCc
Confidence            568888888877 888899999999999998775433


No 10 
>cd07910 MiaE MiaE tRNA-modifying nonheme diiron monooxygenase, ferritin-like diiron-binding domain. MiaE is a nonheme diiron monooxygenase that catalyzes the posttranscriptional allylic hydroxylation of a modified nucleoside in tRNA called 2-methylthio-N-6-isopentenyl adenosine (ms2i6A).  ms2i6A is found at position 37, next to the anticodon at the 3' position in almost all eukaryotic and bacterial tRNA's that read codons beginning with uridine. The miaE gene is absent in Escherichia coli, a finding consistent with the absence of the hydroxylated derivative of ms2i6A in this species.
Probab=33.81  E-value=40  Score=27.09  Aligned_cols=20  Identities=35%  Similarity=0.554  Sum_probs=15.5

Q ss_pred             hHHHHHHHHHhcCCCCCCCCCC
Q 036790           48 FYTQVLHLMNKMNIPAPFRMAL   69 (121)
Q Consensus        48 FY~QVLHLMNkmnLppPF~~~~   69 (121)
                      -|.||+.+|.|.|+  +++...
T Consensus        64 HFeqV~~im~~Rgi--~l~~~~   83 (180)
T cd07910          64 HFEQVLKIMKKRGI--PLGPDS   83 (180)
T ss_pred             HHHHHHHHHHHcCC--CCCCCC
Confidence            47899999999999  344443


No 11 
>PF05009 EBV-NA3:  Epstein-Barr virus nuclear antigen 3 (EBNA-3);  InterPro: IPR007706  This family contains EBNA-3A, -3B, and -3C which are latent infection nuclear proteins important for Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)-induced B-cell immortalisation and the immune response to EBVG infection. ; GO: 0016032 viral reproduction, 0042025 host cell nucleus; PDB: 3SJV_H 3DXA_M.
Probab=33.56  E-value=14  Score=31.30  Aligned_cols=11  Identities=55%  Similarity=0.580  Sum_probs=0.0

Q ss_pred             CcccccccCcc
Q 036790          107 SSESEMEFSDE  117 (121)
Q Consensus       107 s~ESElESddE  117 (121)
                      ||+||+|||||
T Consensus       222 ~eD~e~e~dde  232 (255)
T PF05009_consen  222 SEDSESESDDE  232 (255)
T ss_dssp             -----------
T ss_pred             chhhccccCcc
Confidence            35677777776


No 12 
>PF07708 Tash_PEST:  Tash protein PEST motif;  InterPro: IPR011695 The PEST motif is found in one or more copies in Tash AT-hook proteins from Theileria annulata. Tash proteins are transported to the host nucleus and are thought to be involved in pathogenesis []. The PEST motif is often found in conjunction with the (IPR007480 from INTERPRO), whose function is unknown. These repeats may be part of the PEST motif (a signal for rapid proteolytic degradation) [], though this is not proven. This motif is also found in other T. annulata proteins, which have no other known domains.
Probab=31.57  E-value=22  Score=19.45  Aligned_cols=9  Identities=22%  Similarity=0.239  Sum_probs=4.7

Q ss_pred             cccccCccc
Q 036790          110 SEMEFSDEV  118 (121)
Q Consensus       110 SElESddEe  118 (121)
                      -|++||+|+
T Consensus        10 vEi~SDeee   18 (19)
T PF07708_consen   10 VEIGSDEEE   18 (19)
T ss_pred             EEecccccC
Confidence            355565544


No 13 
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=31.39  E-value=25  Score=31.67  Aligned_cols=17  Identities=41%  Similarity=0.350  Sum_probs=12.1

Q ss_pred             cCCCCcccccccCcccc
Q 036790          103 ADLSSSESEMEFSDEVM  119 (121)
Q Consensus       103 ~e~Ss~ESElESddEe~  119 (121)
                      .+.|-+|||++||||+|
T Consensus       404 ~e~~~~e~el~~ddedd  420 (434)
T KOG3555|consen  404 EETSHSESELTSDDEDD  420 (434)
T ss_pred             ccccccccccccccccc
Confidence            34577889998877554


No 14 
>COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics]
Probab=28.68  E-value=28  Score=33.88  Aligned_cols=16  Identities=56%  Similarity=0.507  Sum_probs=11.2

Q ss_pred             CCCCcccccccCcccc
Q 036790          104 DLSSSESEMEFSDEVM  119 (121)
Q Consensus       104 e~Ss~ESElESddEe~  119 (121)
                      +.|++|||-+|+|||+
T Consensus       964 D~sedeSe~~~~DeE~  979 (1001)
T COG5406         964 DLSEDESENDSSDEED  979 (1001)
T ss_pred             cccccccccccccccc
Confidence            3467778888777765


No 15 
>cd02651 nuc_hydro_IU_UC_XIUA nuc_hydro_IU_UC_XIUA: inosine-uridine preferring, xanthosine-inosine-uridine-adenosine-preferring and, uridine-cytidine preferring nucleoside hydrolases.  Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains proteins similar to nucleoside hydrolases which hydrolyze both pyrimidine and purine ribonucleosides: the inosine-uridine preferring nucleoside hydrolase from Crithidia fasciculata, the inosine-uridine-xanthosine preferring nucleoside hydrolase RihC from Escherichia coli and the xanthosine-inosine-uridine-adenosine-preferring nucleoside hydrolase RihC from Salmonella enterica serovar Typhimurium. This group also contains proteins similar to the pyrimidine-specific uridine-cytidine preferring nucleoside hydrolases URH1 from Saccharomyces cerevisiae, E. coli RihA and E. coli RihB.  E. coli  RihA is equally efficient with uridine a
Probab=27.68  E-value=43  Score=27.07  Aligned_cols=18  Identities=33%  Similarity=0.420  Sum_probs=16.7

Q ss_pred             HHHHHHHHHhCChhHHHH
Q 036790           35 LTNIVNALIAVPRFYTQV   52 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QV   52 (121)
                      |+|||.+|...|+|-.+|
T Consensus       124 LTNlA~al~~~P~~~~~i  141 (302)
T cd02651         124 LTNIALLLRKYPELAERI  141 (302)
T ss_pred             hHHHHHHHHHChhhHhhc
Confidence            789999999999998888


No 16 
>PHA02543 regA translation repressor protein; Provisional
Probab=25.35  E-value=49  Score=25.48  Aligned_cols=28  Identities=25%  Similarity=0.188  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHhCChhHHHHHHHHHhcC
Q 036790           32 GNILTNIVNALIAVPRFYTQVLHLMNKMN   60 (121)
Q Consensus        32 ~~il~nI~~~L~~~p~FY~QVLHLMNkmn   60 (121)
                      +++|++|+.|=....+. .|++|+..|-|
T Consensus        19 rETLtRiGian~k~k~L-yQsCHILqKqG   46 (125)
T PHA02543         19 RETLTRIGIANNKEKKL-YQSCHILQKQG   46 (125)
T ss_pred             HHHHHHHcccccccchh-hhhhhhHhhCC
Confidence            58899999887777444 59999998865


No 17 
>cd02654 nuc_hydro_CjNH nuc_hydro_CjNH. Nucleoside hydrolases similar to Campylobacter jejuni nucleoside hydrolase.  This group contains eukaryotic and bacterial proteins similar to C. jejuni nucleoside hydrolase. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. C. jejuni nucleoside hydrolase is inactive against natural nucleosides or against common nucleoside analogues.
Probab=23.97  E-value=54  Score=27.12  Aligned_cols=18  Identities=39%  Similarity=0.394  Sum_probs=16.8

Q ss_pred             HHHHHHHHHhCChhHHHH
Q 036790           35 LTNIVNALIAVPRFYTQV   52 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QV   52 (121)
                      |+|||.+|...|+|-.+|
T Consensus       139 LTNlA~al~~~P~~~~~i  156 (318)
T cd02654         139 LTNLALALRIDPDFAPLA  156 (318)
T ss_pred             HHHHHHHHHHChhHHHhC
Confidence            799999999999998887


No 18 
>COG5644 Uncharacterized conserved protein [Function unknown]
Probab=22.87  E-value=41  Score=32.35  Aligned_cols=14  Identities=57%  Similarity=0.453  Sum_probs=7.7

Q ss_pred             CCCcccccccCccc
Q 036790          105 LSSSESEMEFSDEV  118 (121)
Q Consensus       105 ~Ss~ESElESddEe  118 (121)
                      +|++|||.||+|++
T Consensus       168 esdsese~e~~d~d  181 (869)
T COG5644         168 ESDSESEIESSDSD  181 (869)
T ss_pred             cccccccccccccC
Confidence            45556666665543


No 19 
>smart00313 PXA Domain associated with PX domains. unpubl. observations
Probab=22.71  E-value=1.2e+02  Score=22.79  Aligned_cols=18  Identities=11%  Similarity=0.196  Sum_probs=13.4

Q ss_pred             HHHhCChhHHHH-HHHHHh
Q 036790           41 ALIAVPRFYTQV-LHLMNK   58 (121)
Q Consensus        41 ~L~~~p~FY~QV-LHLMNk   58 (121)
                      ..++.|+|++|. +++..+
T Consensus       156 ~~lsdPd~iN~~Ii~l~~~  174 (176)
T smart00313      156 THLSDPDTINLCIILLFSS  174 (176)
T ss_pred             HHccCchHHHHHHHHHhhc
Confidence            458899999987 565554


No 20 
>PF07802 GCK:  GCK domain;  InterPro: IPR012891 This domain is found in proteins carrying other domains known to be involved in intracellular signalling pathways (such as IPR001806 from INTERPRO) indicating that it might also be involved in these pathways. It has 4 highly conserved cysteine residues, suggesting that it can bind zinc ions. Moreover, it is found repeated in some members of this family (such as Q9LMF3 from SWISSPROT); this may indicate that these domains are able to interact with one another, raising the possibility that this domain mediates heterodimerisation. 
Probab=22.67  E-value=1.5e+02  Score=20.71  Aligned_cols=27  Identities=11%  Similarity=0.214  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHhCChhHHHHHHHHHhc
Q 036790           33 NILTNIVNALIAVPRFYTQVLHLMNKM   59 (121)
Q Consensus        33 ~il~nI~~~L~~~p~FY~QVLHLMNkm   59 (121)
                      ++.+..-..+.+|+++|.-+|-..+.+
T Consensus        42 e~~~~L~kCM~ahsdYY~P~La~~k~~   68 (76)
T PF07802_consen   42 EATAALRKCMEAHSDYYEPILAAEKAA   68 (76)
T ss_pred             HHHHHHHHHHHhchhHHHHHHHHHHHH
Confidence            345566778899999999999887764


No 21 
>PRK10768 ribonucleoside hydrolase RihC; Provisional
Probab=22.33  E-value=60  Score=26.54  Aligned_cols=18  Identities=33%  Similarity=0.360  Sum_probs=16.7

Q ss_pred             HHHHHHHHHhCChhHHHH
Q 036790           35 LTNIVNALIAVPRFYTQV   52 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QV   52 (121)
                      |+|||.+|...|.|-.+|
T Consensus       126 LTNlA~al~~~P~i~~~i  143 (304)
T PRK10768        126 LTNIALLLSTYPEVKPYI  143 (304)
T ss_pred             HHHHHHHHHHChhhHhhc
Confidence            689999999999998887


No 22 
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=22.02  E-value=50  Score=30.61  Aligned_cols=16  Identities=25%  Similarity=0.563  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHhCCh
Q 036790           32 GNILTNIVNALIAVPR   47 (121)
Q Consensus        32 ~~il~nI~~~L~~~p~   47 (121)
                      .++|.-|--.|++.|.
T Consensus       587 ~~vlveiLLslls~~s  602 (784)
T PF04931_consen  587 SEVLVEILLSLLSQPS  602 (784)
T ss_pred             HHHHHHHHHHHHhCcc
Confidence            5788888888888875


No 23 
>PF12056 DUF3537:  Protein of unknown function (DUF3537);  InterPro: IPR021924  This family of transmembrane proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 427 to 453 amino acids in length. 
Probab=21.85  E-value=62  Score=29.00  Aligned_cols=16  Identities=38%  Similarity=0.320  Sum_probs=11.2

Q ss_pred             CCCcccccccCccccC
Q 036790          105 LSSSESEMEFSDEVMS  120 (121)
Q Consensus       105 ~Ss~ESElESddEe~~  120 (121)
                      .+.++|++||+||+|+
T Consensus       332 ~~~~~sd~es~d~~~~  347 (398)
T PF12056_consen  332 INSSSSDDESGDEEDD  347 (398)
T ss_pred             CCCCccchhhcccCCC
Confidence            4567788888776665


No 24 
>cd02653 nuc_hydro_3 NH_3: A subgroup of nucleoside hydrolases. This group contains eukaryotic and bacterial proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.
Probab=21.68  E-value=64  Score=26.75  Aligned_cols=18  Identities=33%  Similarity=0.357  Sum_probs=16.7

Q ss_pred             HHHHHHHHHhCChhHHHH
Q 036790           35 LTNIVNALIAVPRFYTQV   52 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QV   52 (121)
                      |+|||.+|...|+|..+|
T Consensus       123 LTNlA~al~~~P~~~~~i  140 (320)
T cd02653         123 LTNLALALREEPELPRLL  140 (320)
T ss_pred             hHHHHHHHHHChHHHHhc
Confidence            789999999999999887


No 25 
>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport]
Probab=21.66  E-value=96  Score=27.04  Aligned_cols=29  Identities=21%  Similarity=0.454  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHHhCChhHHHHHHH-HHhcC
Q 036790           32 GNILTNIVNALIAVPRFYTQVLHL-MNKMN   60 (121)
Q Consensus        32 ~~il~nI~~~L~~~p~FY~QVLHL-MNkmn   60 (121)
                      ...|..|+.++..-|+||-.+||. ||.|+
T Consensus       235 ~~~llaiv~c~~n~~~yFA~~L~~amkg~G  264 (321)
T KOG0819|consen  235 EKLLLAIVKCIRNPPAYFAERLRKAMKGLG  264 (321)
T ss_pred             HHHHHHHHHHHcCHHHHHHHHHHHHHhccC
Confidence            357889999999999999999995 88877


No 26 
>cd02649 nuc_hydro_CeIAG nuc_hydro_CeIAG: Nucleoside hydrolases similar to the inosine-adenosine-guanosine-preferring nucleoside hydrolase from Caenorhabditis elegans.  Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains eukaryotic, bacterial and archeal proteins similar to the purine-preferring nucleoside hydrolase (IAG-NH) from C. elegans and the salivary purine nucleosidase from Aedes aegypti.  C. elegans IAG-NH exhibits a high affinity for the substrate analogue p-nitrophenylriboside (p-NPR).
Probab=21.35  E-value=71  Score=26.38  Aligned_cols=19  Identities=26%  Similarity=0.263  Sum_probs=17.1

Q ss_pred             HHHHHHHHHhCChhHHHHH
Q 036790           35 LTNIVNALIAVPRFYTQVL   53 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QVL   53 (121)
                      |+|||.+|...|+|-.+|=
T Consensus       127 LTNlA~al~~~p~~~~~i~  145 (306)
T cd02649         127 LTNLALAYRLDPSLPQKIK  145 (306)
T ss_pred             HHHHHHHHHHChHHHHhcC
Confidence            7999999999999988873


No 27 
>PRK10443 rihA ribonucleoside hydrolase 1; Provisional
Probab=20.95  E-value=75  Score=26.19  Aligned_cols=18  Identities=22%  Similarity=0.370  Sum_probs=16.5

Q ss_pred             HHHHHHHHHhCChhHHHH
Q 036790           35 LTNIVNALIAVPRFYTQV   52 (121)
Q Consensus        35 l~nI~~~L~~~p~FY~QV   52 (121)
                      |+|||.+|...|.|-.+|
T Consensus       127 LTNlA~al~~~P~~~~~i  144 (311)
T PRK10443        127 QTNVALLLASHPELHSKI  144 (311)
T ss_pred             hHHHHHHHHHCchhhhhh
Confidence            689999999999998887


No 28 
>PF01832 Glucosaminidase:  Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase;  InterPro: IPR002901 This domain is found in many different proteins including mannosyl-glycoprotein endo-beta-N-acetylglucosamidase (3.2.1.96 from EC).It is also found in flagellar protein J (P75942 from SWISSPROT), which has been shown to hydrolyse peptidoglycan [].; GO: 0004040 amidase activity, 0009253 peptidoglycan catabolic process; PDB: 3FI7_A 2ZYC_A 3K3T_A.
Probab=20.67  E-value=60  Score=22.67  Aligned_cols=19  Identities=11%  Similarity=0.389  Sum_probs=15.9

Q ss_pred             HhCChhHHHHHHHHHhcCC
Q 036790           43 IAVPRFYTQVLHLMNKMNI   61 (121)
Q Consensus        43 ~~~p~FY~QVLHLMNkmnL   61 (121)
                      ++.+.+...|..+|+++||
T Consensus       118 atd~~Y~~kl~~i~~~~~l  136 (136)
T PF01832_consen  118 ATDPNYAEKLASIIKSYNL  136 (136)
T ss_dssp             SS-TTHHHHHHHHHHCCTG
T ss_pred             CCCHHHHHHHHHHHHHcCC
Confidence            4568888999999999997


No 29 
>COG3159 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.66  E-value=1.2e+02  Score=25.21  Aligned_cols=28  Identities=25%  Similarity=0.636  Sum_probs=25.5

Q ss_pred             HHHHHHHhCChhHHHHHHHHHhcCCCCC
Q 036790           37 NIVNALIAVPRFYTQVLHLMNKMNIPAP   64 (121)
Q Consensus        37 nI~~~L~~~p~FY~QVLHLMNkmnLppP   64 (121)
                      .++.-|..+|+|+.|==||.-.|+||-+
T Consensus         8 ~VadyL~~hPeFf~~h~~Ll~~L~lph~   35 (218)
T COG3159           8 DVADYLRQHPEFFIQHAELLEELRLPHP   35 (218)
T ss_pred             HHHHHHHhCcHHHHhCHHHHHHcCCCCC
Confidence            4778899999999999999999999965


No 30 
>KOG2925 consensus Predicted translation initiation factor related to eIF-1A [Translation, ribosomal structure and biogenesis]
Probab=20.55  E-value=63  Score=25.92  Aligned_cols=20  Identities=30%  Similarity=0.423  Sum_probs=11.5

Q ss_pred             hHHHHHHHHHhcCCCCCCCC
Q 036790           48 FYTQVLHLMNKMNIPAPFRM   67 (121)
Q Consensus        48 FY~QVLHLMNkmnLppPF~~   67 (121)
                      |.-||+.|=..---|-=|..
T Consensus        90 ~~d~vr~lqk~g~WPe~F~d  109 (167)
T KOG2925|consen   90 FFDQVRLLQKSGEWPEIFKD  109 (167)
T ss_pred             ccHHHHHHHHcCCcchhhhh
Confidence            55677666555555555543


No 31 
>PF13812 PPR_3:  Pentatricopeptide repeat domain
Probab=20.26  E-value=91  Score=16.06  Aligned_cols=14  Identities=14%  Similarity=0.271  Sum_probs=10.0

Q ss_pred             HHHHHHHHhcCCCC
Q 036790           50 TQVLHLMNKMNIPA   63 (121)
Q Consensus        50 ~QVLHLMNkmnLpp   63 (121)
                      .+|++.|.+-|+.|
T Consensus        21 ~~~~~~M~~~gv~P   34 (34)
T PF13812_consen   21 LQLFDEMKEQGVKP   34 (34)
T ss_pred             HHHHHHHHHhCCCC
Confidence            46677888877754


Done!