Citrus Sinensis ID: 036802

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180

MDERISGFYVKAGHVRAGNGNDNSDTGTKCGRWNPTSEQVKVLTDLFTSGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQKRRKVSVDYDHQKDLIRHVDKISSPKREAHDEPERVIETLQLFPLNSFDDQESEKLRMHGDEFKEEGTTFSYTIGTEMDHPPLDLRLNFL

ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccEEEEccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccEEccccccccccccccccccc

******************************GRWNPTSEQVKVLTDLFTSGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNH*********************************************LQLFPL**********************************HPPLDLRLNFL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDERISGFYVKAGHVRAGNGNDNSDTGTKCGRWNPTSEQVKVLTDLFTSGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQKRRKVSVDYDHQKDLIRHVDKISSPKREAHDEPERVIETLQLFPLNSFDDQESEKLRMHGDEFKEEGTTFSYTIGTEMDHPPLDLRLNFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
WUSCHEL-related homeobox 5	Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM).	probable	Q8H1D2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CUF, chain A
Confidence level:confident
Coverage over the Query: 33-96
View the alignment between query and template
View the model in PyMOL