BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036810
         (163 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1O5O|A Chain A, Crystal Structure Of Uracil Phosphoribosyltransferase
           (Tm0721) From Thermotoga Maritima At 2.30 A Resolution
 pdb|1O5O|B Chain B, Crystal Structure Of Uracil Phosphoribosyltransferase
           (Tm0721) From Thermotoga Maritima At 2.30 A Resolution
 pdb|1O5O|C Chain C, Crystal Structure Of Uracil Phosphoribosyltransferase
           (Tm0721) From Thermotoga Maritima At 2.30 A Resolution
 pdb|1O5O|D Chain D, Crystal Structure Of Uracil Phosphoribosyltransferase
           (Tm0721) From Thermotoga Maritima At 2.30 A Resolution
          Length = 221

 Score = 28.5 bits (62), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 122 GYKVSSY-LPLVPTERIAKVFSNGVVESQPLASAGH 156
           GY+++   + +VP  R   V ++G++E  P AS GH
Sbjct: 76  GYRINDKDIVVVPILRAGLVMADGILELLPNASVGH 111


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.124    0.344 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,912,658
Number of Sequences: 62578
Number of extensions: 120628
Number of successful extensions: 328
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 328
Number of HSP's gapped (non-prelim): 6
length of query: 163
length of database: 14,973,337
effective HSP length: 91
effective length of query: 72
effective length of database: 9,278,739
effective search space: 668069208
effective search space used: 668069208
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 47 (22.7 bits)