Citrus Sinensis ID: 036845


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MASSSNSYNSPCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDSANADLIRYACNEIPPGSQLPAPAPLSVSSIHPVIPRQRPIRIGNEGEGFYQPPSSYTHPSYILPWNDNPSPSGDINHGGGGGGGGR
ccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**********PCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDSANADLIRYACNEI***********************************************YIL***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSNSYNSPCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxEIPPGSQLPAPAPLSVSSIHPVIPRQRPIRIGNEGEGFYQPPSSYTHPSYILPWNDNPSPSGDINHGGGGGGGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LATERAL ORGAN BOUNDARIES Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.probableQ9FML4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZN, chain A
Confidence level:probable
Coverage over the Query: 88-93
View the alignment between query and template
View the model in PyMOL