Citrus Sinensis ID: 036845

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--

MASSSNSYNSPCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDSANADLIRYACNEIPPGSQLPAPAPLSVSSIHPVIPRQRPIRIGNEGEGFYQPPSSYTHPSYILPWNDNPSPSGDINHGGGGGGGGR

ccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********PCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDSANADLIRYACNEI***********************************************YIL***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSSNSYNSPCAACKFLRRKCVPGCIFAPYFPPEEPQKFVNVHKIFGASNMTKLLNDLLPHQREDAVNSLAYEAEARVRDPVYGCVGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxEIPPGSQLPAPAPLSVSSIHPVIPRQRPIRIGNEGEGFYQPPSSYTHPSYILPWNDNPSPSGDINHGGGGGGGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein LATERAL ORGAN BOUNDARIES	Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.	probable	Q9FML4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZN, chain A
Confidence level:probable
Coverage over the Query: 88-93
View the alignment between query and template
View the model in PyMOL