Query         036862
Match_columns 82
No_of_seqs    101 out of 125
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:09:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036862hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00165 hypothetical protein; 100.0 4.5E-43 9.7E-48  232.1   3.8   76    1-78      1-88  (88)
  2 PF12609 DUF3774:  Wound-induce 100.0 3.1E-36 6.7E-41  194.8   2.6   67   11-77      1-79  (79)
  3 KOG4195 Transient receptor pot  69.2     1.9   4E-05   33.8   0.4   18   63-80     97-114 (275)
  4 PHA00665 major capsid protein   64.8     3.3 7.1E-05   33.4   1.0   14   67-80    169-182 (329)
  5 TIGR02276 beta_rpt_yvtn 40-res  24.7      44 0.00096   17.0   1.0   13   68-80      4-16  (42)
  6 PF01376 Enterotoxin_b:  Heat-l  21.2      33 0.00072   23.3   0.1   18   16-33     63-91  (102)
  7 PF06449 DUF1082:  Mitochondria  21.2      49  0.0011   20.1   0.8   11   67-77      7-17  (51)
  8 KOG0916 1,3-beta-glucan syntha  20.6      25 0.00055   33.7  -0.7   20   63-82    296-316 (1679)
  9 PF13540 RCC1_2:  Regulator of   19.9      36 0.00078   17.5   0.0    8   72-79     20-27  (30)
 10 PF06554 Olfactory_mark:  Olfac  18.8      59  0.0013   23.7   0.9    9   64-72    122-130 (151)

No 1  
>PLN00165 hypothetical protein; Provisional
Probab=100.00  E-value=4.5e-43  Score=232.10  Aligned_cols=76  Identities=45%  Similarity=0.861  Sum_probs=60.2

Q ss_pred             CCccchhHHHHHHhHHHHHhhcccccccccCcCccch-----------hhhcccCCCccc-ccccccccccccccccccc
Q 036862            1 MSTSAGKAWIVALSVGALEAFRDQAGICRWNNSIRSF-----------AQVNLIYAPASD-FRDMINFSSVFRNKNSMEK   68 (82)
Q Consensus         1 m~~~~~~aw~vAaSvgaVEalKDQ~g~CRwn~~~rS~-----------sqa~~lss~ss~-~~~~~~~~k~k~aEESLRt   68 (82)
                      |+ +.+++||||+||||||+|||| |+||||+.|||+           +|++++++++++ .....++++.+|+||||||
T Consensus         1 Ms-~~~r~w~vAaSvgaVEalkDQ-G~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s~~~~~~k~kq~EEsLRt   78 (88)
T PLN00165          1 MS-HMGKAWIVAASVGAVEALKDQ-GFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVREEKAKQSEESLRT   78 (88)
T ss_pred             Cc-cchhHHHHHHHHHHHhhcccc-CeeehhhHHHHHHHHHHhccccccccccCCCcchhhhhhhhccccccchHHhhhe
Confidence            77 789999999999999999999 999999666654           445555444322 2222356788999999999


Q ss_pred             eeeecccCCC
Q 036862           69 IMLLGCWGPN   78 (82)
Q Consensus        69 VMyLSCWGPn   78 (82)
                      ||||||||||
T Consensus        79 VMyLSCWGPN   88 (88)
T PLN00165         79 VMYLSCWGPN   88 (88)
T ss_pred             eeEecccCCC
Confidence            9999999998


No 2  
>PF12609 DUF3774:  Wound-induced protein;  InterPro: IPR022251  This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this. 
Probab=100.00  E-value=3.1e-36  Score=194.76  Aligned_cols=67  Identities=40%  Similarity=0.737  Sum_probs=52.7

Q ss_pred             HHHhHHHHHhhcccccccccCcCccchhhhcc--c----------CCCcccccccccccccccccccccceeeecccCC
Q 036862           11 VALSVGALEAFRDQAGICRWNNSIRSFAQVNL--I----------YAPASDFRDMINFSSVFRNKNSMEKIMLLGCWGP   77 (82)
Q Consensus        11 vAaSvgaVEalKDQ~g~CRwn~~~rS~sqa~~--l----------ss~ss~~~~~~~~~k~k~aEESLRtVMyLSCWGP   77 (82)
                      ||+||||||+||||+|+||||+++||++|..+  +          +++++.......+++.+|+|||||||||||||||
T Consensus         1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~~~~~~~~~~k~aEEsLRtVMyLSCWGP   79 (79)
T PF12609_consen    1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSSSAAAEEEKRKQAEESLRTVMYLSCWGP   79 (79)
T ss_pred             CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccccccccccccchhhhhhceeEEEeccCc
Confidence            68999999999999999999999988777543  2          1111111223367889999999999999999999


No 3  
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=69.16  E-value=1.9  Score=33.85  Aligned_cols=18  Identities=33%  Similarity=0.706  Sum_probs=13.1

Q ss_pred             cccccceeeecccCCCcc
Q 036862           63 KNSMEKIMLLGCWGPNTV   80 (82)
Q Consensus        63 EESLRtVMyLSCWGPn~~   80 (82)
                      .-.|+--=-|+|||||-.
T Consensus        97 RTGL~GRG~LgrwGPNHa  114 (275)
T KOG4195|consen   97 RTGLRGRGSLGRWGPNHA  114 (275)
T ss_pred             cccccccccccccCCccc
Confidence            345666667999999953


No 4  
>PHA00665 major capsid protein
Probab=64.76  E-value=3.3  Score=33.38  Aligned_cols=14  Identities=43%  Similarity=0.897  Sum_probs=12.2

Q ss_pred             cceeeecccCCCcc
Q 036862           67 EKIMLLGCWGPNTV   80 (82)
Q Consensus        67 RtVMyLSCWGPn~~   80 (82)
                      -|=.||.+||||++
T Consensus       169 ~tSiwlv~wg~~~v  182 (329)
T PHA00665        169 NASIWLVVWGPNTL  182 (329)
T ss_pred             cceEEEEEEcCCee
Confidence            36789999999997


No 5  
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat. This repeat of about 40 amino acids is found in up to 14 copies per protein. Archaea Methanosarcina mazei and Methanosarcina acetivorans each have over 10 genes that encode tandem copies of this repeat, which is also found in other species. PSIPRED predicts with high confidence that each 40-residue repeats contains four beta strands. This model overlaps somewhat with the NHL repeat (Pfam pfam01436) and also shows sequence similarity to the WD domain, G-beta repeat (Pfam pfam00400).
Probab=24.68  E-value=44  Score=17.04  Aligned_cols=13  Identities=31%  Similarity=0.337  Sum_probs=9.8

Q ss_pred             ceeeecccCCCcc
Q 036862           68 KIMLLGCWGPNTV   80 (82)
Q Consensus        68 tVMyLSCWGPn~~   80 (82)
                      +-.|.+|||.+++
T Consensus         4 ~~lyv~~~~~~~v   16 (42)
T TIGR02276         4 TKLYVTNSGSNTV   16 (42)
T ss_pred             CEEEEEeCCCCEE
Confidence            3478889988865


No 6  
>PF01376 Enterotoxin_b:  Heat-labile enterotoxin beta chain;  InterPro: IPR001835  Escherichia coli heat-labile enterotoxin is a bacterial protein toxin with an AB5 multimer structure, in which the B pentamer has a membrane-binding function and the A chain (IPR001144 from INTERPRO) is needed for enzymatic activity []. The B subunits are arranged as a donut-shaped pentamer, each subunit participating in ~30 hydrogen bonds and 6 salt bridges with its two neighbours []. The A subunit has a less well-defined secondary structure. It predominantly interacts with the pentamer via the C-terminal A2 fragment, which runs through the charged central pore of the B subunits. A putative catalytic residue in the A1 fragment (Glu112) lies close to a hydrophobic region, which packs two loops together. It is thought that this region might be important for catalysis and membrane translocation [].; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1LTA_D 2XRS_O 1LTS_E 1LTT_H 1TET_P 1JQY_Y 1PZI_D 1DJR_E 1EEF_D 1LTB_E ....
Probab=21.24  E-value=33  Score=23.27  Aligned_cols=18  Identities=39%  Similarity=0.889  Sum_probs=12.5

Q ss_pred             HHHHhhcccc-----------cccccCcC
Q 036862           16 GALEAFRDQA-----------GICRWNNS   33 (82)
Q Consensus        16 gaVEalKDQ~-----------g~CRwn~~   33 (82)
                      .++|.+||..           .+|-||+.
T Consensus        63 k~iermkdtlr~ay~t~~kv~klcvwnnk   91 (102)
T PF01376_consen   63 KAIERMKDTLRIAYLTEIKVSKLCVWNNK   91 (102)
T ss_dssp             HHHHHHHHHHHHHHHHT-EEEEEEEETTS
T ss_pred             HHHHHHHhHHHHHHHhhcchhheeeecCC
Confidence            3567777764           68999853


No 7  
>PF06449 DUF1082:  Mitochondrial domain of unknown function (DUF1082);  InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=21.18  E-value=49  Score=20.12  Aligned_cols=11  Identities=45%  Similarity=1.072  Sum_probs=9.5

Q ss_pred             cceeeecccCC
Q 036862           67 EKIMLLGCWGP   77 (82)
Q Consensus        67 RtVMyLSCWGP   77 (82)
                      |++-|+||+|-
T Consensus         7 ~kit~iscFGE   17 (51)
T PF06449_consen    7 RKITLISCFGE   17 (51)
T ss_pred             eEEEEEEEece
Confidence            68899999985


No 8  
>KOG0916 consensus 1,3-beta-glucan synthase/callose synthase catalytic subunit [Cell wall/membrane/envelope biogenesis]
Probab=20.63  E-value=25  Score=33.73  Aligned_cols=20  Identities=35%  Similarity=0.684  Sum_probs=15.0

Q ss_pred             cccccceeeecccCC-CccCC
Q 036862           63 KNSMEKIMLLGCWGP-NTVRF   82 (82)
Q Consensus        63 EESLRtVMyLSCWGP-n~~~~   82 (82)
                      ++=|.-..||=|||- |++||
T Consensus       296 ~~ll~iaLYLLiWGEA~NvRF  316 (1679)
T KOG0916|consen  296 RMLLQIALYLLIWGEANNVRF  316 (1679)
T ss_pred             HHHHHHHHHHHhhhhhhcccc
Confidence            334444578999999 88998


No 9  
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=19.91  E-value=36  Score=17.48  Aligned_cols=8  Identities=50%  Similarity=1.402  Sum_probs=4.5

Q ss_pred             ecccCCCc
Q 036862           72 LGCWGPNT   79 (82)
Q Consensus        72 LSCWGPn~   79 (82)
                      |-|||-|.
T Consensus        20 v~~wG~n~   27 (30)
T PF13540_consen   20 VYCWGDNN   27 (30)
T ss_dssp             EEEEE--T
T ss_pred             EEEEcCCc
Confidence            66899774


No 10 
>PF06554 Olfactory_mark:  Olfactory marker protein;  InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=18.78  E-value=59  Score=23.67  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=7.5

Q ss_pred             ccccceeee
Q 036862           64 NSMEKIMLL   72 (82)
Q Consensus        64 ESLRtVMyL   72 (82)
                      ...|||||+
T Consensus       122 AKiRKVMYF  130 (151)
T PF06554_consen  122 AKIRKVMYF  130 (151)
T ss_dssp             HHCTTEEEE
T ss_pred             HHHHhhhee
Confidence            468999996


Done!