Query 036862
Match_columns 82
No_of_seqs 101 out of 125
Neff 4.1
Searched_HMMs 46136
Date Fri Mar 29 06:09:47 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036862.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036862hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN00165 hypothetical protein; 100.0 4.5E-43 9.7E-48 232.1 3.8 76 1-78 1-88 (88)
2 PF12609 DUF3774: Wound-induce 100.0 3.1E-36 6.7E-41 194.8 2.6 67 11-77 1-79 (79)
3 KOG4195 Transient receptor pot 69.2 1.9 4E-05 33.8 0.4 18 63-80 97-114 (275)
4 PHA00665 major capsid protein 64.8 3.3 7.1E-05 33.4 1.0 14 67-80 169-182 (329)
5 TIGR02276 beta_rpt_yvtn 40-res 24.7 44 0.00096 17.0 1.0 13 68-80 4-16 (42)
6 PF01376 Enterotoxin_b: Heat-l 21.2 33 0.00072 23.3 0.1 18 16-33 63-91 (102)
7 PF06449 DUF1082: Mitochondria 21.2 49 0.0011 20.1 0.8 11 67-77 7-17 (51)
8 KOG0916 1,3-beta-glucan syntha 20.6 25 0.00055 33.7 -0.7 20 63-82 296-316 (1679)
9 PF13540 RCC1_2: Regulator of 19.9 36 0.00078 17.5 0.0 8 72-79 20-27 (30)
10 PF06554 Olfactory_mark: Olfac 18.8 59 0.0013 23.7 0.9 9 64-72 122-130 (151)
No 1
>PLN00165 hypothetical protein; Provisional
Probab=100.00 E-value=4.5e-43 Score=232.10 Aligned_cols=76 Identities=45% Similarity=0.861 Sum_probs=60.2
Q ss_pred CCccchhHHHHHHhHHHHHhhcccccccccCcCccch-----------hhhcccCCCccc-ccccccccccccccccccc
Q 036862 1 MSTSAGKAWIVALSVGALEAFRDQAGICRWNNSIRSF-----------AQVNLIYAPASD-FRDMINFSSVFRNKNSMEK 68 (82)
Q Consensus 1 m~~~~~~aw~vAaSvgaVEalKDQ~g~CRwn~~~rS~-----------sqa~~lss~ss~-~~~~~~~~k~k~aEESLRt 68 (82)
|+ +.+++||||+||||||+|||| |+||||+.|||+ +|++++++++++ .....++++.+|+||||||
T Consensus 1 Ms-~~~r~w~vAaSvgaVEalkDQ-G~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s~~~~~~k~kq~EEsLRt 78 (88)
T PLN00165 1 MS-HMGKAWIVAASVGAVEALKDQ-GFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVREEKAKQSEESLRT 78 (88)
T ss_pred Cc-cchhHHHHHHHHHHHhhcccc-CeeehhhHHHHHHHHHHhccccccccccCCCcchhhhhhhhccccccchHHhhhe
Confidence 77 789999999999999999999 999999666654 445555444322 2222356788999999999
Q ss_pred eeeecccCCC
Q 036862 69 IMLLGCWGPN 78 (82)
Q Consensus 69 VMyLSCWGPn 78 (82)
||||||||||
T Consensus 79 VMyLSCWGPN 88 (88)
T PLN00165 79 VMYLSCWGPN 88 (88)
T ss_pred eeEecccCCC
Confidence 9999999998
No 2
>PF12609 DUF3774: Wound-induced protein; InterPro: IPR022251 This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this.
Probab=100.00 E-value=3.1e-36 Score=194.76 Aligned_cols=67 Identities=40% Similarity=0.737 Sum_probs=52.7
Q ss_pred HHHhHHHHHhhcccccccccCcCccchhhhcc--c----------CCCcccccccccccccccccccccceeeecccCC
Q 036862 11 VALSVGALEAFRDQAGICRWNNSIRSFAQVNL--I----------YAPASDFRDMINFSSVFRNKNSMEKIMLLGCWGP 77 (82)
Q Consensus 11 vAaSvgaVEalKDQ~g~CRwn~~~rS~sqa~~--l----------ss~ss~~~~~~~~~k~k~aEESLRtVMyLSCWGP 77 (82)
||+||||||+||||+|+||||+++||++|..+ + +++++.......+++.+|+|||||||||||||||
T Consensus 1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~~~~~~~~~~k~aEEsLRtVMyLSCWGP 79 (79)
T PF12609_consen 1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSSSAAAEEEKRKQAEESLRTVMYLSCWGP 79 (79)
T ss_pred CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccccccccccccchhhhhhceeEEEeccCc
Confidence 68999999999999999999999988777543 2 1111111223367889999999999999999999
No 3
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=69.16 E-value=1.9 Score=33.85 Aligned_cols=18 Identities=33% Similarity=0.706 Sum_probs=13.1
Q ss_pred cccccceeeecccCCCcc
Q 036862 63 KNSMEKIMLLGCWGPNTV 80 (82)
Q Consensus 63 EESLRtVMyLSCWGPn~~ 80 (82)
.-.|+--=-|+|||||-.
T Consensus 97 RTGL~GRG~LgrwGPNHa 114 (275)
T KOG4195|consen 97 RTGLRGRGSLGRWGPNHA 114 (275)
T ss_pred cccccccccccccCCccc
Confidence 345666667999999953
No 4
>PHA00665 major capsid protein
Probab=64.76 E-value=3.3 Score=33.38 Aligned_cols=14 Identities=43% Similarity=0.897 Sum_probs=12.2
Q ss_pred cceeeecccCCCcc
Q 036862 67 EKIMLLGCWGPNTV 80 (82)
Q Consensus 67 RtVMyLSCWGPn~~ 80 (82)
-|=.||.+||||++
T Consensus 169 ~tSiwlv~wg~~~v 182 (329)
T PHA00665 169 NASIWLVVWGPNTL 182 (329)
T ss_pred cceEEEEEEcCCee
Confidence 36789999999997
No 5
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat. This repeat of about 40 amino acids is found in up to 14 copies per protein. Archaea Methanosarcina mazei and Methanosarcina acetivorans each have over 10 genes that encode tandem copies of this repeat, which is also found in other species. PSIPRED predicts with high confidence that each 40-residue repeats contains four beta strands. This model overlaps somewhat with the NHL repeat (Pfam pfam01436) and also shows sequence similarity to the WD domain, G-beta repeat (Pfam pfam00400).
Probab=24.68 E-value=44 Score=17.04 Aligned_cols=13 Identities=31% Similarity=0.337 Sum_probs=9.8
Q ss_pred ceeeecccCCCcc
Q 036862 68 KIMLLGCWGPNTV 80 (82)
Q Consensus 68 tVMyLSCWGPn~~ 80 (82)
+-.|.+|||.+++
T Consensus 4 ~~lyv~~~~~~~v 16 (42)
T TIGR02276 4 TKLYVTNSGSNTV 16 (42)
T ss_pred CEEEEEeCCCCEE
Confidence 3478889988865
No 6
>PF01376 Enterotoxin_b: Heat-labile enterotoxin beta chain; InterPro: IPR001835 Escherichia coli heat-labile enterotoxin is a bacterial protein toxin with an AB5 multimer structure, in which the B pentamer has a membrane-binding function and the A chain (IPR001144 from INTERPRO) is needed for enzymatic activity []. The B subunits are arranged as a donut-shaped pentamer, each subunit participating in ~30 hydrogen bonds and 6 salt bridges with its two neighbours []. The A subunit has a less well-defined secondary structure. It predominantly interacts with the pentamer via the C-terminal A2 fragment, which runs through the charged central pore of the B subunits. A putative catalytic residue in the A1 fragment (Glu112) lies close to a hydrophobic region, which packs two loops together. It is thought that this region might be important for catalysis and membrane translocation [].; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1LTA_D 2XRS_O 1LTS_E 1LTT_H 1TET_P 1JQY_Y 1PZI_D 1DJR_E 1EEF_D 1LTB_E ....
Probab=21.24 E-value=33 Score=23.27 Aligned_cols=18 Identities=39% Similarity=0.889 Sum_probs=12.5
Q ss_pred HHHHhhcccc-----------cccccCcC
Q 036862 16 GALEAFRDQA-----------GICRWNNS 33 (82)
Q Consensus 16 gaVEalKDQ~-----------g~CRwn~~ 33 (82)
.++|.+||.. .+|-||+.
T Consensus 63 k~iermkdtlr~ay~t~~kv~klcvwnnk 91 (102)
T PF01376_consen 63 KAIERMKDTLRIAYLTEIKVSKLCVWNNK 91 (102)
T ss_dssp HHHHHHHHHHHHHHHHT-EEEEEEEETTS
T ss_pred HHHHHHHhHHHHHHHhhcchhheeeecCC
Confidence 3567777764 68999853
No 7
>PF06449 DUF1082: Mitochondrial domain of unknown function (DUF1082); InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=21.18 E-value=49 Score=20.12 Aligned_cols=11 Identities=45% Similarity=1.072 Sum_probs=9.5
Q ss_pred cceeeecccCC
Q 036862 67 EKIMLLGCWGP 77 (82)
Q Consensus 67 RtVMyLSCWGP 77 (82)
|++-|+||+|-
T Consensus 7 ~kit~iscFGE 17 (51)
T PF06449_consen 7 RKITLISCFGE 17 (51)
T ss_pred eEEEEEEEece
Confidence 68899999985
No 8
>KOG0916 consensus 1,3-beta-glucan synthase/callose synthase catalytic subunit [Cell wall/membrane/envelope biogenesis]
Probab=20.63 E-value=25 Score=33.73 Aligned_cols=20 Identities=35% Similarity=0.684 Sum_probs=15.0
Q ss_pred cccccceeeecccCC-CccCC
Q 036862 63 KNSMEKIMLLGCWGP-NTVRF 82 (82)
Q Consensus 63 EESLRtVMyLSCWGP-n~~~~ 82 (82)
++=|.-..||=|||- |++||
T Consensus 296 ~~ll~iaLYLLiWGEA~NvRF 316 (1679)
T KOG0916|consen 296 RMLLQIALYLLIWGEANNVRF 316 (1679)
T ss_pred HHHHHHHHHHHhhhhhhcccc
Confidence 334444578999999 88998
No 9
>PF13540 RCC1_2: Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=19.91 E-value=36 Score=17.48 Aligned_cols=8 Identities=50% Similarity=1.402 Sum_probs=4.5
Q ss_pred ecccCCCc
Q 036862 72 LGCWGPNT 79 (82)
Q Consensus 72 LSCWGPn~ 79 (82)
|-|||-|.
T Consensus 20 v~~wG~n~ 27 (30)
T PF13540_consen 20 VYCWGDNN 27 (30)
T ss_dssp EEEEE--T
T ss_pred EEEEcCCc
Confidence 66899774
No 10
>PF06554 Olfactory_mark: Olfactory marker protein; InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=18.78 E-value=59 Score=23.67 Aligned_cols=9 Identities=22% Similarity=0.567 Sum_probs=7.5
Q ss_pred ccccceeee
Q 036862 64 NSMEKIMLL 72 (82)
Q Consensus 64 ESLRtVMyL 72 (82)
...|||||+
T Consensus 122 AKiRKVMYF 130 (151)
T PF06554_consen 122 AKIRKVMYF 130 (151)
T ss_dssp HHCTTEEEE
T ss_pred HHHHhhhee
Confidence 468999996
Done!