Citrus Sinensis ID: 036879

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------103
TNVGRDQSALLALKAHVTNDPLNVLASNWSTNTSVCNWFGVTCSPRHRRVTALNLAYMGLLGTIPPELGNLSFLSLLNVTNNSFSGTLPIQLSNLRRLKYLSFRSNNFSSIEIPPWLDSFPKLEHLYLDGNSFIGTIPPSICNISSLLTLDLSFNQLQGHVPSSILNIPSLLAIDLSNNQFSGPMPSIYNTSPLQNIDMQYNSLAELHLAYNQLSGQIPSTLFECKQLKILSLSVNNFIGSIPREIGNITMLKGLYLVYTNLTGEIQGLQVLALSSNRLTGVIPPEIINISSLTVLSLTANNLLGNLPSNIGHSLPNLQQLILGGNRLTGPIPSSISNASMLTLIDMPYNLFSGFIPNSLGFCHPYDELGFLTSLTNCKDLRKLILSENPLSGVLPISIGNLSNAMDVLYLSACNIKGSIPSEIGNLNNLTTLHLETNELTGSIPKAIGRLQKLQGLYLQHNKLQGSITTDLCGLRSLSEFYSDGNELNGSLPQCLDSLISLRTLSLGFNRLTSVIPSSLWSLRDILNVNLSSNSLNGTLPVEIGNLKVVTKIDLSRNDLSGEIPSSIGDLKNMQHLSLADNKFQGSIPDSLGGLTSLNFLDMSSNNLSGEIPNSLKALSLLKFLNLSFNGLQGQVPHGGPFTNLSSQSFVGNKGLCGAPELKFPACKAKSNKIARKTDKNIFIYVFPIAASILLVLSLSVVLIRRQKRNTGLQIDEEMSPEVTWRRISYQELFRATDGFSENNLLGKGSFGSVYKGTLSDGMQIAVKVFNLELEGTLRSFDAECEILGSIRHRNLVKIISTCSSDHFKALVLEYMPNGSLENWMYNKNRSFDILQRLNMVIDVASALEYLHYDHPTPIIHCDLNPSNILLNESMVACLSDFGISKLLGDETSMTQTQTLATIGYMAPEWKLSRKGDVYSYGIILMETFTKKKPTDELFVGEISLKSRVNDSLHGKIINVVDINLLQKEDAYLTAKEQCVSSVLSLAMQCTRESAEERINIKEALTKLLKIRNTLLTNIENSSDKRYCN
cccHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccccEEEEEccccccCECccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccHHcccccccccccccccccEEEcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEECccccccccccHHHHHcccccEEcccccccCCccccccccccccccccccccccccccccEEEcccccccccccHHHccccccccEEEccccCEEECccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHcccccccEEEcccccccccccccccccccccEEEccccccccccccHHccccccccEEcccccccccccHHHccccccccEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEECccccEEEEEEEccccccccHHHHHHHHHHccccccccccEEEEEEcccccEEEEcccccccccHHcccccccccHHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHcccccccccccccccHHHHHHHHcccccccECccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccc
****RDQSALLALKAHVTNDPLNVLASNWSTNTSVCNWFGVTCSPRHRRVTALNLAYMGLLGTIPPELGNLSFLSLLNVTNNSFSGTLPIQLSNLRRLKYLSFRSNNFSSIEIPPWLDSFPKLEHLYLDGNSFIGTIPPSICNISSLLTLDLSFNQLQGHVPSSILNIPSLLAIDLSNNQFSGPMPSIYNTSPLQNIDMQYNSLAELHLAYNQLSGQIPSTLFECKQLKILSLSVNNFIGSIPREIGNITMLKGLYLVYTNLTGEIQGLQVLALSSNRLTGVIPPEIINISSLTVLSLTANNLLGNLPSNIGHSLPNLQQLILGGNRLTGPIPSSISNASMLTLIDMPYNLFSGFIPNSLGFCHPYDELGFLTSLTNCKDLRKLILSENPLSGVLPISIGNLSNAMDVLYLSACNIKGSIPSEIGNLNNLTTLHLETNELTGSIPKAIGRLQKLQGLYLQHNKLQGSITTDLCGLRSLSEFYSDGNELNGSLPQCLDSLISLRTLSLGFNRLTSVIPSSLWSLRDILNVNLSSNSLNGTLPVEIGNLKVVTKIDLSRNDLSGEIPSSIGDLKNMQHLSLADNKFQGSIPDSLGGLTSLNFLDMSSNNLSGEIPNSLKALSLLKFLNLSFNGLQGQVPHGGPFTNLSSQSFVGNKGLCGAPELKFP**********RKTDKNIFIYVFPIAASILLVLSLSVVLIRRQKRN**********PEVTWRRISYQELFRATDGFSENNLLGKGSFGSVYKGTLSDGMQIAVKVFNLELEGTLRSFDAECEILGSIRHRNLVKIISTCSSDHFKALVLEYMPNGSLENWMYNKNRSFDILQRLNMVIDVASALEYLHYDHPTPIIHCDLNPSNILLNESMVACLSDFGISKLLGDETSMTQTQTLATIGYMAPEWKLSRKGDVYSYGIILMETFTKKKPTDELFVGEISLKSRVNDSLHGKIINVVDINLLQKEDAYLTAKEQCVSSVLSLAMQCTRESAEERINIKEALTKLLKIRNTLL*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TNVGRDQSALLALKAHVTNDPLNVLASNWSTNTSVCNWFGVTCSPRHRRVTALNLAYMGLLGTIPPELGNLSFLSLLNVTNNSFSGTLPIQLSNLRRLKYLSFRSNNFSSIEIPPWLDSFPKLEHLYLDGNSFIGTIPPSICNISSLLTLDLSFNQLQGHVPSSILNIPSLLAIDLSNNQFSGPMPSIYNTSPLQNIDMQYNSLAELHLAYNQLSGQIPSTLFECKQLKILSLSVNNFIGSIPREIGNITMLKGLYLVYTNLTGEIQGLQVLALSSNRLTGVIPPEIINISSLTVLSLTANNLLGNLPSNIGHSLPNLQQLILGGNRLTGPIPSSISNASMLTLIDMPYNLFSGFIPNSLGFCHPYDELGFLTSLTNCKDLRKLILSENPLSGVLPISIGNLSNAMDVLYLSACNIKGSIPSEIGNLNNLTTLHLETNELTGSIPKAIGRLQKLQGLYLQHNKLQGSITTDLCGLRSLSEFYSDGNELNGSLPQCLDSLISLRTLSLGFNRLTSVIPSSLWSLRDILNVNLSSNSLNGTLPVEIGNLKVVTKIDLSRNDLSGEIPSSIGDLKNMQHLSLADNKFQGSIPDSLGGLTSLNFLDMSSNNLSGEIPNSLKALSLLKFLNLSFNGLQGQVPHGGPFTNLSSQSFVGNKGLCGAPELKFPACKAKSNKIARKTDKNIFIYVFPIAASILLVLSLSVVLIRRQKRNTGLQIDEEMSPEVTWRRISYQELFRATDGFSENNLLGKGSFGSVYKGTLSDGMQIAVKVFNLELEGTLRSFDAECEILGSIRHRNLVKIISTCSSDHFKALVLEYMPNGSLENWMYNKNRSFDILQRLNMVIDVASALEYLHYDHPTPIIHCDLNPSNILLNESMVACLSDFGISKLLGDETSMTQTQTLATIGYMAPEWKLSRKGDVYSYGIILMETFTKKKPTDELFVGEISLKSRVNDSLHGKIINVVDINLLQKEDAYLTAKEQCVSSVLSLAMQCTRESAEERINIKEALTKLLKIRNTLLTNIENSSDKRYCN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At3g47570 probableC0LGP4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H6T, chain A
Confidence level:very confident
Coverage over the Query: 427-635
View the alignment between query and template
View the model in PyMOL
Template: 1H6T, chain A
Confidence level:very confident
Coverage over the Query: 408-610
View the alignment between query and template
View the model in PyMOL
Template: 3A79, chain B
Confidence level:very confident
Coverage over the Query: 51-245,286-362,373-403,426-613
View the alignment between query and template
View the model in PyMOL
Template: 2ID5, chain A
Confidence level:very confident
Coverage over the Query: 271-359,375-638
View the alignment between query and template
View the model in PyMOL
Template: 3O6N, chain A
Confidence level:very confident
Coverage over the Query: 290-360,376-660
View the alignment between query and template
View the model in PyMOL
Template: 1WWL, chain A
Confidence level:very confident
Coverage over the Query: 29-186,218-248,266-354
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 2-183,218-253,271-329
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 3-362,376-670
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 831-946,959-1014
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 725-1010
View the alignment between query and template
View the model in PyMOL
Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 724-1008
View the alignment between query and template
View the model in PyMOL