BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 036886
(85 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1DKR|A Chain A, Crystal Structures Of Bacillus Subtilis
Phosphoribosylpyrophosphate Synthetase: Molecular Basis
Of Allosteric Inhibition And Activation.
pdb|1DKR|B Chain B, Crystal Structures Of Bacillus Subtilis
Phosphoribosylpyrophosphate Synthetase: Molecular Basis
Of Allosteric Inhibition And Activation.
pdb|1DKU|A Chain A, Crystal Structures Of Bacillus Subtilis
Phosphoribosylpyrophosphate Synthetase: Molecular Basis
Of Allosteric Inhibition And Activation.
pdb|1DKU|B Chain B, Crystal Structures Of Bacillus Subtilis
Phosphoribosylpyrophosphate Synthetase: Molecular Basis
Of Allosteric Inhibition And Activation.
pdb|1IBS|A Chain A, Phosphoribosyldiphosphate Synthetase In Complex With
Cadmium Ions
pdb|1IBS|B Chain B, Phosphoribosyldiphosphate Synthetase In Complex With
Cadmium Ions
Length = 317
Score = 28.9 bits (63), Expect = 0.68, Method: Composition-based stats.
Identities = 13/31 (41%), Positives = 17/31 (54%)
Query: 25 IYSLSCYIIRKQKDPSKAHQTKLDVIVKALK 55
I CYII+ DP H +L ++V ALK
Sbjct: 54 IRGCDCYIIQSTSDPVNEHIMELLIMVDALK 84
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.141 0.424
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,929,585
Number of Sequences: 62578
Number of extensions: 49668
Number of successful extensions: 88
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 87
Number of HSP's gapped (non-prelim): 1
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)