Query         036898
Match_columns 396
No_of_seqs    152 out of 947
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:30:40 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036898.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036898hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 7.4E-37 1.6E-41  264.6   7.3  121    1-140     7-129 (129)
  2 PTZ00444 hypothetical protein;  20.7      27 0.00059   33.1  -0.5   31  306-346    47-77  (184)
  3 smart00265 BH4 BH4 Bcl-2 homol  14.2 1.9E+02  0.0041   19.5   2.4   19    4-22      4-22  (27)
  4 PF05865 Cypo_polyhedrin:  Cypo   8.9 3.2E+02   0.007   26.0   3.0   27   85-111   141-168 (248)
  5 smart00707 RPEL Repeat in Dros   8.5 2.3E+02   0.005   18.9   1.4   10    1-10      9-18  (26)
  6 KOG4286 Dystrophin-like protei   8.5      78  0.0017   36.3  -1.4   54  101-168   613-678 (966)
  7 PF12590 Acyl-thio_N:  Acyl-ATP   8.5 1.2E+02  0.0027   27.3   0.1   11  325-335    93-103 (129)
  8 PF04700 Baculo_gp41:  Structur   8.2 3.3E+02  0.0072   26.1   2.8   20    4-23      6-27  (186)
  9 PF02180 BH4:  Bcl-2 homology r   7.6 3.6E+02  0.0078   18.2   2.0   17    5-21      5-21  (27)
 10 PF07960 CBP4:  CBP4;  InterPro   7.3 2.2E+02  0.0048   25.7   1.1   11    2-12     30-40  (128)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=7.4e-37  Score=264.56  Aligned_cols=121  Identities=45%  Similarity=0.831  Sum_probs=92.1

Q ss_pred             CCCChHHHHHHHHHHHHcCCCCCC-CceeecCCCCCCchhhhHhhhhhhhcCCCceEEEeccccccCCCCCccceeccCC
Q 036898            1 FCPLDWELLVCYLKKKVKNEPLPP-NRIMEIKLYNFTPEQLKQELKVKYKDLREKEMFFFTPRERKHQNGTRLNRVTGSG   79 (396)
Q Consensus         1 F~PTDEELV~~YL~~Ki~G~plp~-~~I~evDVY~~ePweLp~~~~~~~~~~~e~eWYFFspr~rK~~nG~R~nRttG~g   79 (396)
                      |+|||+|||.+||++|+.|.+++. ++|+++|||+++||+|+..     ...++++||||+++++++.+|.|.+|++   
T Consensus         7 F~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~-----~~~~~~~~yFF~~~~~~~~~~~r~~R~~---   78 (129)
T PF02365_consen    7 FRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAK-----FKGGDEEWYFFSPRKKKYPNGGRPNRVT---   78 (129)
T ss_dssp             E---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHH-----SSS-SSEEEEEEE----------S-EEE---
T ss_pred             ecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhh-----ccCCCceEEEEEecccccCCcccccccc---
Confidence            899999999999999999999887 8999999999999999953     3346779999999999999999999988   


Q ss_pred             CCCCCceEeecCCCceEee-CCeeEEEEEEeeeecCCCCCCCCCCCCCccccCeeEEeeecC
Q 036898           80 PDSGSGYWKSTGADKSIKF-KGALVGFKKQLVYYRKNPEAGGEGEKNDWIKTDWIMHEFRVP  140 (396)
Q Consensus        80 ~~~ggG~WK~tG~~k~I~~-~G~vVG~KKtLvFy~gr~p~G~~G~~~~~~KT~WvMhEYrL~  140 (396)
                         ++|+||.+|+.+.|.+ .|.+||+|++|+||.++.+++        .+|+|+||||+|.
T Consensus        79 ---~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~--------~kt~W~M~EY~L~  129 (129)
T PF02365_consen   79 ---GGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNG--------KKTGWVMHEYSLE  129 (129)
T ss_dssp             ---TTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS---------EEEEEEEEEEEE-
T ss_pred             ---cceEEeecccccccccccceeeeeEEEEEEEeccCCCC--------CcCCeEEEEEEeC
Confidence               8999999999999998 689999999999998877777        8999999999984


No 2  
>PTZ00444 hypothetical protein; Provisional
Probab=20.73  E-value=27  Score=33.15  Aligned_cols=31  Identities=39%  Similarity=0.459  Sum_probs=21.9

Q ss_pred             cccccCCcchhhhhccCCCCCcccchhhhccChhhhccccc
Q 036898          306 SIAFESMPTQAQVFADNVNLPEWSSLITAVVDPEIQKLDSY  346 (396)
Q Consensus       306 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  346 (396)
                      -.++|+|||++||.+.          |-++-+-+|.|||.-
T Consensus        47 k~~~e~lPt~~~v~~~----------~~~id~e~~~kl~~~   77 (184)
T PTZ00444         47 KLASETLPTPEQVSAK----------IHRIDKEVIKKLDKD   77 (184)
T ss_pred             HHHHhcCCCHHHHHHH----------HHhcCHHHHHHHHHH
Confidence            3689999999997654          555555566677653


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=14.21  E-value=1.9e+02  Score=19.47  Aligned_cols=19  Identities=26%  Similarity=0.333  Sum_probs=15.0

Q ss_pred             ChHHHHHHHHHHHHcCCCC
Q 036898            4 LDWELLVCYLKKKVKNEPL   22 (396)
Q Consensus         4 TDEELV~~YL~~Ki~G~pl   22 (396)
                      +-.|||.+|+.-|+.-...
T Consensus         4 ~nRelV~~yv~yKLsQrgy   22 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGY   22 (27)
T ss_pred             chHHHHHHHHHHHHhhcCC
Confidence            4579999999999965443


No 4  
>PF05865 Cypo_polyhedrin:  Cypovirus polyhedrin protein;  InterPro: IPR008464 This family consists of several Cypovirus polyhedrin proteins. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells [].; PDB: 2OH7_A 2OH5_A 2OH6_A.
Probab=8.89  E-value=3.2e+02  Score=26.04  Aligned_cols=27  Identities=26%  Similarity=0.571  Sum_probs=17.9

Q ss_pred             ceEeecC-CCceEeeCCeeEEEEEEeee
Q 036898           85 GYWKSTG-ADKSIKFKGALVGFKKQLVY  111 (396)
Q Consensus        85 G~WK~tG-~~k~I~~~G~vVG~KKtLvF  111 (396)
                      --|.++| +-+.|...|++||+...|..
T Consensus       141 hpweatgikyrki~~dgeivgyshyfel  168 (248)
T PF05865_consen  141 HPWEATGIKYRKIHRDGEIVGYSHYFEL  168 (248)
T ss_dssp             -S-B--GGG-EEEEETTEEEEEEEEEE-
T ss_pred             CCccccCceEEEeeccceEeeeeeeeec
Confidence            4599998 56778888999999988865


No 5  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=8.54  E-value=2.3e+02  Score=18.88  Aligned_cols=10  Identities=30%  Similarity=-0.004  Sum_probs=8.2

Q ss_pred             CCCChHHHHH
Q 036898            1 FCPLDWELLV   10 (396)
Q Consensus         1 F~PTDEELV~   10 (396)
                      ++|+-+|||.
T Consensus         9 ~RP~~eeLv~   18 (26)
T smart00707        9 QRPTREELEE   18 (26)
T ss_pred             cCCCHHHHHH
Confidence            4799999985


No 6  
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton]
Probab=8.48  E-value=78  Score=36.28  Aligned_cols=54  Identities=17%  Similarity=0.375  Sum_probs=37.6

Q ss_pred             eeEEEE-EEee----------eecCCCCCCCCCCCCCccccCeeEEeeecCCCCCCCCCCCCCCcc-ceEEEEEEEcCCC
Q 036898          101 ALVGFK-KQLV----------YYRKNPEAGGEGEKNDWIKTDWIMHEFRVPNNPTPRKKDGTNMEL-DWALCKIYKKVYK  168 (396)
Q Consensus       101 ~vVG~K-KtLv----------Fy~gr~p~G~~G~~~~~~KT~WvMhEYrL~~~~~~~~~~~~~~~~-d~VLCRIykK~~~  168 (396)
                      .+||+| |+|+          |..|++.+|        .|++.-|.||.....+..      .++. --|||--|+.++.
T Consensus       613 pIvG~RyR~l~~fn~dlCq~CF~sgraak~--------hk~~~pM~Ey~~~tts~~------d~rdfak~L~nkfr~~~~  678 (966)
T KOG4286|consen  613 PIIGFRYRSLKHFNYDICQSCFFSGRAAKG--------HKMHYPMVEYCTPTTSGE------DVRDFAKVLKNKFRTKRY  678 (966)
T ss_pred             ccceeeeeehhhcChhHHhhHhhhcccccC--------CCCCCCceeeeCCCCChh------hHHHHHHHHHhhhccchh
Confidence            678888 4443          557788777        999999999998875531      1222 4478887776553


No 7  
>PF12590 Acyl-thio_N:  Acyl-ATP thioesterase;  InterPro: IPR021113 This entry represents the N-terminal domain of acyl-ATP thioesterases from bacteria and eukaryotes. These proteins are typically between 120 and 131 amino acids in length. The plant acyl-acyl carrier protein (ACP) thioesterases (TEs) play an essential role in chain termination during de novo fatty acid synthesis [].; GO: 0016790 thiolester hydrolase activity
Probab=8.47  E-value=1.2e+02  Score=27.33  Aligned_cols=11  Identities=55%  Similarity=1.277  Sum_probs=9.7

Q ss_pred             CCcccchhhhc
Q 036898          325 LPEWSSLITAV  335 (396)
Q Consensus       325 ~~~~~~~~~~~  335 (396)
                      |||||-|+.|+
T Consensus        93 LPDWSMLLAAI  103 (129)
T PF12590_consen   93 LPDWSMLLAAI  103 (129)
T ss_pred             CccHHHHHHHH
Confidence            99999998775


No 8  
>PF04700 Baculo_gp41:  Structural glycoprotein p40/gp41 conserved region;  InterPro: IPR006790 This is a family of viral structural glycoproteins [] from the baculoviridae.; GO: 0005198 structural molecule activity, 0019012 virion
Probab=8.16  E-value=3.3e+02  Score=26.09  Aligned_cols=20  Identities=40%  Similarity=0.547  Sum_probs=14.4

Q ss_pred             ChHHHHHHH--HHHHHcCCCCC
Q 036898            4 LDWELLVCY--LKKKVKNEPLP   23 (396)
Q Consensus         4 TDEELV~~Y--L~~Ki~G~plp   23 (396)
                      +|+|||.||  |.+|..|...+
T Consensus         6 sDe~Li~yY~~L~K~~g~~~~~   27 (186)
T PF04700_consen    6 SDEELIEYYANLEKKYGGSDVP   27 (186)
T ss_pred             cHHHHHHHHHHHHHHhCCCCCC
Confidence            799999998  44666665544


No 9  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=7.63  E-value=3.6e+02  Score=18.22  Aligned_cols=17  Identities=24%  Similarity=0.356  Sum_probs=13.5

Q ss_pred             hHHHHHHHHHHHHcCCC
Q 036898            5 DWELLVCYLKKKVKNEP   21 (396)
Q Consensus         5 DEELV~~YL~~Ki~G~p   21 (396)
                      -.|||.+|+.-|+.-+.
T Consensus         5 nR~lV~~yi~yKLsQrg   21 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRG   21 (27)
T ss_dssp             HHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHhhhcC
Confidence            47999999999986443


No 10 
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=7.28  E-value=2.2e+02  Score=25.70  Aligned_cols=11  Identities=36%  Similarity=0.537  Sum_probs=9.3

Q ss_pred             CCChHHHHHHH
Q 036898            2 CPLDWELLVCY   12 (396)
Q Consensus         2 ~PTDEELV~~Y   12 (396)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            59999999765


Done!