Query         036922
Match_columns 135
No_of_seqs    69 out of 71
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:44:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036922.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036922hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0446 Vacuolar sorting prote  99.9   6E-28 1.3E-32  217.2   1.5  120    5-134   176-301 (657)
  2 PF01031 Dynamin_M:  Dynamin ce  99.6 4.8E-16 1.1E-20  124.2   4.8   82   45-133     1-83  (295)
  3 smart00053 DYNc Dynamin, GTPas  99.2 1.2E-11 2.7E-16   99.8   3.8   65    6-80    170-239 (240)
  4 PF10662 PduV-EutP:  Ethanolami  95.1   0.018 3.9E-07   44.4   2.8   33   23-56     89-121 (143)
  5 KOG0447 Dynamin-like GTP bindi  95.0   0.051 1.1E-06   52.1   5.7   68   22-99    478-547 (980)
  6 COG4917 EutP Ethanolamine util  89.1    0.31 6.6E-06   38.9   2.3   27   26-54     93-119 (148)
  7 COG0699 Predicted GTPases (dyn  81.2    0.65 1.4E-05   38.7   0.8  106    5-130    97-204 (546)
  8 cd01857 HSR1_MMR1 HSR1/MMR1.    54.6      32 0.00069   24.4   4.6   18   22-39     41-58  (141)
  9 smart00755 Grip golgin-97, Ran  52.7     8.5 0.00018   24.8   1.2   31   90-120     2-33  (46)
 10 cd04163 Era Era subfamily.  Er  42.6      35 0.00077   22.6   3.1   27   22-48    110-136 (168)
 11 PRK15467 ethanolamine utilizat  41.8      29 0.00062   25.3   2.7   19   22-40     90-108 (158)
 12 PF12102 DUF3578:  Domain of un  41.4      13 0.00029   29.3   1.0   18   54-71     50-67  (188)
 13 cd01858 NGP_1 NGP-1.  Autoanti  40.1      16 0.00036   26.2   1.2   18   22-39     38-55  (157)
 14 PF01465 GRIP:  GRIP domain;  I  39.8      15 0.00033   23.2   0.9   31   90-120     3-35  (46)
 15 cd00880 Era_like Era (E. coli   37.6      22 0.00048   23.0   1.4   20   22-41    103-122 (163)
 16 COG0523 Putative GTPases (G3E   37.4      28  0.0006   29.9   2.4   29   28-58    150-178 (323)
 17 cd01882 BMS1 Bms1.  Bms1 is an  36.6      41  0.0009   26.3   3.1   17   24-40    134-150 (225)
 18 PRK11331 5-methylcytosine-spec  36.4      26 0.00057   32.0   2.2   19   54-72     40-58  (459)
 19 TIGR03598 GTPase_YsxC ribosome  36.1      20 0.00044   26.0   1.2   18   22-39    128-145 (179)
 20 cd01849 YlqF_related_GTPase Yl  36.0      21 0.00046   25.7   1.3   17   22-38     28-44  (155)
 21 cd01894 EngA1 EngA1 subfamily.  33.5      26 0.00056   23.6   1.3   20   22-41    104-123 (157)
 22 cd04164 trmE TrmE (MnmE, ThdF,  33.0      28  0.0006   23.4   1.4   18   22-39    106-123 (157)
 23 cd04165 GTPBP1_like GTPBP1-lik  32.7      45 0.00098   26.3   2.8   29   22-50    137-167 (224)
 24 PF10414 CysG_dimeriser:  Siroh  32.4      38 0.00082   21.7   1.9   17  115-131     8-24  (60)
 25 cd01879 FeoB Ferrous iron tran  32.0      29 0.00063   23.6   1.4   18   22-39    100-117 (158)
 26 cd01895 EngA2 EngA2 subfamily.  31.0      65  0.0014   21.8   3.0   30   22-51    112-141 (174)
 27 cd04104 p47_IIGP_like p47 (47-  29.9      57  0.0012   24.5   2.8   17   22-38    106-122 (197)
 28 cd04178 Nucleostemin_like Nucl  29.5      31 0.00068   26.3   1.3   19   22-40     29-47  (172)
 29 cd01855 YqeH YqeH.  YqeH is an  29.0      35 0.00076   25.2   1.5   18   22-39     60-77  (190)
 30 cd01887 IF2_eIF5B IF2/eIF5B (i  29.0 1.2E+02  0.0027   20.8   4.1   19   22-40    101-119 (168)
 31 cd04587 CBS_pair_CAP-ED_DUF294  28.4      33 0.00072   21.9   1.1   14   24-37     99-112 (113)
 32 TIGR00073 hypB hydrogenase acc  28.1      77  0.0017   24.1   3.3   26   26-51    151-176 (207)
 33 cd04615 CBS_pair_2 The CBS dom  27.2      44 0.00095   21.4   1.5   16   22-37     97-112 (113)
 34 KOG1432 Predicted DNA repair e  26.1      65  0.0014   29.3   2.8   36   53-99    127-162 (379)
 35 cd01862 Rab7 Rab7 subfamily.    25.6 1.4E+02  0.0031   20.5   3.9   15   23-37    109-123 (172)
 36 cd01876 YihA_EngB The YihA (En  25.2      78  0.0017   21.1   2.5   20   22-41    109-128 (170)
 37 cd04582 CBS_pair_ABC_OpuCA_ass  25.2      48   0.001   21.0   1.4   16   22-37     90-105 (106)
 38 cd04613 CBS_pair_SpoIVFB_EriC_  25.0      48   0.001   21.0   1.4   15   23-37     99-113 (114)
 39 cd01891 TypA_BipA TypA (tyrosi  23.4   2E+02  0.0044   21.1   4.6   29   22-50    116-145 (194)
 40 cd04169 RF3 RF3 subfamily.  Pe  23.3      76  0.0017   25.8   2.6   40   22-63    122-162 (267)
 41 cd01886 EF-G Elongation factor  23.1      72  0.0016   26.0   2.4   40   22-63    115-155 (270)
 42 cd04119 RJL RJL (RabJ-Like) su  22.8 1.1E+02  0.0023   20.8   2.9   15   23-37    110-124 (168)
 43 cd00882 Ras_like_GTPase Ras-li  22.3      55  0.0012   20.6   1.3   20   22-41    101-120 (157)
 44 cd04607 CBS_pair_NTP_transfera  21.9      61  0.0013   20.9   1.5   17   22-38     97-113 (113)
 45 PRK05935 biotin--protein ligas  21.7      89  0.0019   24.7   2.6   27  106-132   157-183 (190)
 46 cd04605 CBS_pair_MET2_assoc Th  21.2      55  0.0012   20.8   1.1   15   22-36     94-108 (110)
 47 TIGR00101 ureG urease accessor  20.9      74  0.0016   24.7   2.0   12   27-38    141-152 (199)
 48 COG1162 Predicted GTPases [Gen  20.7      90  0.0019   27.2   2.6   36   16-51    101-138 (301)
 49 cd04639 CBS_pair_26 The CBS do  20.6      57  0.0012   20.8   1.1   13   24-36     97-109 (111)
 50 cd04594 CBS_pair_EriC_assoc_ar  20.6      56  0.0012   21.0   1.1   15   22-36     88-102 (104)
 51 cd04606 CBS_pair_Mg_transporte  20.3      66  0.0014   20.7   1.4   16   22-37     92-107 (109)
 52 cd04638 CBS_pair_25 The CBS do  20.2      59  0.0013   20.7   1.1   16   22-37     90-105 (106)
 53 cd01856 YlqF YlqF.  Proteins o  20.1      63  0.0014   23.7   1.4   17   22-38     45-61  (171)

No 1  
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]
Probab=99.94  E-value=6e-28  Score=217.20  Aligned_cols=120  Identities=23%  Similarity=0.278  Sum_probs=113.7

Q ss_pred             CCCCCCCcccccccccc-----cCceeeeeeehhhccccchhHHHHHHHHHHhCCCCCCCCCceEEEeccceehhhcccC
Q 036922            5 ELPPCESSITSRVLSFL-----QGTRTVGVISKIDQASADQKALAAVQALLLNQGPPKTADISWVALIGQSVSIATAQSG   79 (135)
Q Consensus         5 ~~Pan~diatS~alkla-----~g~RTiGVitKiD~~~~~t~alaAv~alL~~qG~~~~~~~pWVavInrSq~ia~Adin   79 (135)
                      -.|||.|++||+|||+|     +|.||||||||+|+||+||+   |++. |+  |+.++++.|||++|||+|    .+|+
T Consensus       176 v~~an~d~ats~alkiarevDp~g~RTigvitK~DlmdkGt~---~~~~-L~--g~~~~l~~g~v~vvnR~q----~di~  245 (657)
T KOG0446|consen  176 VTPANSDIATSPALVVAREVDPGGSRTLEVITKFDFMDKGTN---AVTR-LV--GRPITLKVGYVGVVNRSQ----SIID  245 (657)
T ss_pred             ccchhhhhhcCHHHHHHHhhCCCccchhHHhhhHHhhhcCCc---ceee-ec--CCccccccceeeeeccch----hhhh
Confidence            46999999999999999     89999999999999999999   7777 54  999999999999999999    8998


Q ss_pred             CCCcHHHHHHHHHHHHhhhh-cCCcccchhHHHHHHHHHHHHHHHHHhhccccccC
Q 036922           80 SESSLETAWRAESESLKSIL-TGAPQSKLGRIALVDALAQQIRKRMKVRVPNVLSG  134 (135)
Q Consensus        80 se~~m~tArr~E~E~f~s~~-~g~~~sklG~~~L~~~Lsk~i~~~ik~RlP~ilsg  134 (135)
                      ...+|.+|..+|+.||.+.| |++...++|+.+|++.|.++|...|+.++|.|.+.
T Consensus       246 ~~k~~~~al~~e~~~f~~~p~y~~~~~~~g~p~La~~L~~~l~~hi~~~lP~l~~~  301 (657)
T KOG0446|consen  246 FKKSILEALNDEVPSFESVPSYPILLTISGVPYLALLLPGYLQSHIRDQLPELKTK  301 (657)
T ss_pred             hhhhHHHHHHhhhhhhhccccccccccccCcchHHHHHHHHHHHHHHhcCcHHHHH
Confidence            77799999999999999999 99999999999999999999999999999998753


No 2  
>PF01031 Dynamin_M:  Dynamin central region;  InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles. At the N terminus of dynamin is a GTPase domain (see IPR001401 from INTERPRO), and at the C terminus is a PH domain (see IPR001849 from INTERPRO). Between these two domains lies a central region of unknown function, which this entry represents.; GO: 0005525 GTP binding; PDB: 3ZVR_A 2AKA_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D 1JWY_B 1JX2_B 3SZR_A ....
Probab=99.61  E-value=4.8e-16  Score=124.15  Aligned_cols=82  Identities=20%  Similarity=0.275  Sum_probs=70.9

Q ss_pred             HHHHHHHhCCCCCCCCCceEEEeccceehhhcccCCCCcHHHHHHHHHHHHhhhh-cCCcccchhHHHHHHHHHHHHHHH
Q 036922           45 AVQALLLNQGPPKTADISWVALIGQSVSIATAQSGSESSLETAWRAESESLKSIL-TGAPQSKLGRIALVDALAQQIRKR  123 (135)
Q Consensus        45 Av~alL~~qG~~~~~~~pWVavInrSq~ia~Adinse~~m~tArr~E~E~f~s~~-~g~~~sklG~~~L~~~Lsk~i~~~  123 (135)
                      |+++ |.  |..+.++++||||+||||    .|++...|++.|+++|.+||++.| |..+++++|+.+|++.|++.|...
T Consensus         1 ~~~i-L~--n~~~pLklGy~~V~nrsq----~di~~~~s~~~a~~~E~~fF~~~~~~~~~~~~~G~~~L~~~L~~~L~~~   73 (295)
T PF01031_consen    1 AMDI-LR--NKVIPLKLGYVGVKNRSQ----QDINDGKSIEEARQKEKEFFSNHPWYSSPADRCGTPALRKRLSELLVEH   73 (295)
T ss_dssp             SHHH-HT--TSSS--TT-EEEE--S-H----HHHHTTEEHHHHHHHHHHHHHHSTTTGGGGGGSSHHHHHHHHHHHHHHH
T ss_pred             ChHH-hC--CCeeccCCCeEEEecCCc----cccccCCCHHHHHHHHHHHHhcccccCCcccccchHHHHHHHHHHHHHH
Confidence            4566 64  999999999999999999    999999999999999999999998 888999999999999999999999


Q ss_pred             HHhhcccccc
Q 036922          124 MKVRVPNVLS  133 (135)
Q Consensus       124 ik~RlP~ils  133 (135)
                      |+..||.|.+
T Consensus        74 I~~~LP~l~~   83 (295)
T PF01031_consen   74 IRKSLPSLKS   83 (295)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHhCcHHHH
Confidence            9999999864


No 3  
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=99.19  E-value=1.2e-11  Score=99.78  Aligned_cols=65  Identities=23%  Similarity=0.307  Sum_probs=58.4

Q ss_pred             CCCCCCcccccccccc-----cCceeeeeeehhhccccchhHHHHHHHHHHhCCCCCCCCCceEEEeccceehhhcccCC
Q 036922            6 LPPCESSITSRVLSFL-----QGTRTVGVISKIDQASADQKALAAVQALLLNQGPPKTADISWVALIGQSVSIATAQSGS   80 (135)
Q Consensus         6 ~Pan~diatS~alkla-----~g~RTiGVitKiD~~~~~t~alaAv~alL~~qG~~~~~~~pWVavInrSq~ia~Adins   80 (135)
                      .+++.|+++++++++|     .|.|||||+||+|..+.+++   +++. |.  |..+.++++|++|.||||    +|++.
T Consensus       170 vda~~d~~~~d~l~ia~~ld~~~~rti~ViTK~D~~~~~~~---~~~~-~~--~~~~~l~~g~~~v~nr~~----~d~~~  239 (240)
T smart00053      170 TPANVDLANSDALKLAKEVDPQGERTIGVITKLDLMDEGTD---ARDI-LE--NKLLPLRRGYIGVVNRSQ----KDIEG  239 (240)
T ss_pred             EECCCCCCchhHHHHHHHHHHcCCcEEEEEECCCCCCccHH---HHHH-Hh--CCccccCCCEEEEECCCh----HHhhc
Confidence            3688999999999999     79999999999999999999   7777 65  888999999999999999    88853


No 4  
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=95.14  E-value=0.018  Score=44.38  Aligned_cols=33  Identities=36%  Similarity=0.406  Sum_probs=24.9

Q ss_pred             CceeeeeeehhhccccchhHHHHHHHHHHhCCCC
Q 036922           23 GTRTVGVISKIDQASADQKALAAVQALLLNQGPP   56 (135)
Q Consensus        23 g~RTiGVitKiD~~~~~t~alaAv~alL~~qG~~   56 (135)
                      ..+.||||||+|+..++.+.-.|.+. |.+.|-.
T Consensus        89 ~~pvIGVITK~Dl~~~~~~i~~a~~~-L~~aG~~  121 (143)
T PF10662_consen   89 NKPVIGVITKIDLPSDDANIERAKKW-LKNAGVK  121 (143)
T ss_pred             CCCEEEEEECccCccchhhHHHHHHH-HHHcCCC
Confidence            46899999999999666666667666 6666654


No 5  
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only]
Probab=94.96  E-value=0.051  Score=52.12  Aligned_cols=68  Identities=24%  Similarity=0.377  Sum_probs=51.8

Q ss_pred             cCceeeeeeehhhccccchhHHHHHHHHHHhCCCCCCCC-CceEEEe-ccceehhhcccCCCCcHHHHHHHHHHHHhhhh
Q 036922           22 QGTRTVGVISKIDQASADQKALAAVQALLLNQGPPKTAD-ISWVALI-GQSVSIATAQSGSESSLETAWRAESESLKSIL   99 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~alaAv~alL~~qG~~~~~~-~pWVavI-nrSq~ia~Adinse~~m~tArr~E~E~f~s~~   99 (135)
                      .|.|||=|+||+|++.+.--.-.-++-+|+  |.-+.-+ .++.||| ||.        ||..|.++.|+-|-+||+++-
T Consensus       478 ~GrRTIfVLTKVDlAEknlA~PdRI~kIle--GKLFPMKALGYfaVVTGrG--------nssdSIdaIR~YEE~FF~nSk  547 (980)
T KOG0447|consen  478 HGRRTIFVLTKVDLAEKNVASPSRIQQIIE--GKLFPMKALGYFAVVTGKG--------NSSESIEAIREYEEEFFQNSK  547 (980)
T ss_pred             CCCeeEEEEeecchhhhccCCHHHHHHHHh--cCccchhhcceeEEEecCC--------CcchhHHHHHHHHHHHhhhhH
Confidence            699999999999999884333337777787  7655432 4667776 444        478899999999999999875


No 6  
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=89.09  E-value=0.31  Score=38.89  Aligned_cols=27  Identities=33%  Similarity=0.527  Sum_probs=18.7

Q ss_pred             eeeeeehhhccccchhHHHHHHHHHHhCC
Q 036922           26 TVGVISKIDQASADQKALAAVQALLLNQG   54 (135)
Q Consensus        26 TiGVitKiD~~~~~t~alaAv~alL~~qG   54 (135)
                      +|||+||+|++. +.+. +++.-+|...|
T Consensus        93 vIgvVTK~DLae-d~dI-~~~~~~L~eaG  119 (148)
T COG4917          93 VIGVVTKADLAE-DADI-SLVKRWLREAG  119 (148)
T ss_pred             eEEEEecccccc-hHhH-HHHHHHHHHcC
Confidence            999999999995 4443 34555555455


No 7  
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only]
Probab=81.25  E-value=0.65  Score=38.67  Aligned_cols=106  Identities=10%  Similarity=0.017  Sum_probs=79.3

Q ss_pred             CCCCCCCcccccccccc-cCceeeeeeehhhccccchhHHHHHHHHHHhCCCCCCCCCceEEEeccceehhhcccCCCCc
Q 036922            5 ELPPCESSITSRVLSFL-QGTRTVGVISKIDQASADQKALAAVQALLLNQGPPKTADISWVALIGQSVSIATAQSGSESS   83 (135)
Q Consensus         5 ~~Pan~diatS~alkla-~g~RTiGVitKiD~~~~~t~alaAv~alL~~qG~~~~~~~pWVavInrSq~ia~Adinse~~   83 (135)
                      ...++.+.++..+.+.+ ++.|   |.+|+|.++.+++   +...          ....-+.+++..+    .++-....
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~---~~~~----------~~~~~~~~~~~~~----~~~~~~~~  156 (546)
T COG0699          97 GIAPNADEEAELSIEVIREADR---VPTKINFLNGGTN---LTLI----------LGNGDVLVVDALE----TDIQLLKT  156 (546)
T ss_pred             chhhhhhhccchhhHhhhhhcc---hhHHHHHHhcCCc---eeee----------eccccccccCchh----HHHHhccc
Confidence            45677888888888888 6666   9999999999999   4210          1222255555655    55667777


Q ss_pred             HHHHHHHHHHHHhhhh-cCCcccchhHHHHHHHHHHHHHHHHHhhccc
Q 036922           84 LETAWRAESESLKSIL-TGAPQSKLGRIALVDALAQQIRKRMKVRVPN  130 (135)
Q Consensus        84 m~tArr~E~E~f~s~~-~g~~~sklG~~~L~~~Lsk~i~~~ik~RlP~  130 (135)
                      ...+=..|.++|...+ +..-....+..++...+++++...+..-.|-
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  204 (546)
T COG0699         157 ALEALVKELEYFAEHPLLEDNEKLVLLPYLKKLLSKILELHLRLLPKY  204 (546)
T ss_pred             chHHHHHHHHHhhcCccccccccccCChhhhhhhhhhHHHHHHhcChh
Confidence            8888899999999999 7666667999999999999888877765543


No 8  
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=54.59  E-value=32  Score=24.44  Aligned_cols=18  Identities=11%  Similarity=0.276  Sum_probs=14.5

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+...|=|+||+|+..+.
T Consensus        41 ~~k~~iivlNK~DL~~~~   58 (141)
T cd01857          41 PRKKNILLLNKADLLTEE   58 (141)
T ss_pred             CCCcEEEEEechhcCCHH
Confidence            377889999999997544


No 9  
>smart00755 Grip golgin-97, RanBP2alpha,Imh1p and p230/golgin-245.
Probab=52.66  E-value=8.5  Score=24.81  Aligned_cols=31  Identities=23%  Similarity=0.248  Sum_probs=23.0

Q ss_pred             HHHHHHhhhhcCCcccchh-HHHHHHHHHHHH
Q 036922           90 AESESLKSILTGAPQSKLG-RIALVDALAQQI  120 (135)
Q Consensus        90 ~E~E~f~s~~~g~~~sklG-~~~L~~~Lsk~i  120 (135)
                      .+.||+|++.++-..++=+ |..|+..|+..|
T Consensus         2 ~n~eYLKNVll~fl~~~e~~r~~ll~vi~tlL   33 (46)
T smart00755        2 ANFEYLKNVLLQFLTLRESERETLLKVISTVL   33 (46)
T ss_pred             ccHHHHHHHHHHHhccCcchHHHHHHHHHHHh
Confidence            3689999999655555555 788888887665


No 10 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=42.55  E-value=35  Score=22.64  Aligned_cols=27  Identities=22%  Similarity=0.303  Sum_probs=17.9

Q ss_pred             cCceeeeeeehhhccccchhHHHHHHH
Q 036922           22 QGTRTVGVISKIDQASADQKALAAVQA   48 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~alaAv~a   48 (135)
                      .+...+-|+||+|++..........+.
T Consensus       110 ~~~~~iiv~nK~Dl~~~~~~~~~~~~~  136 (168)
T cd04163         110 SKTPVILVLNKIDLVKDKEDLLPLLEK  136 (168)
T ss_pred             hCCCEEEEEEchhccccHHHHHHHHHH
Confidence            357789999999998644443333334


No 11 
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=41.84  E-value=29  Score=25.31  Aligned_cols=19  Identities=42%  Similarity=0.520  Sum_probs=14.8

Q ss_pred             cCceeeeeeehhhccccch
Q 036922           22 QGTRTVGVISKIDQASADQ   40 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t   40 (135)
                      .+...++|++|+|+.+.+.
T Consensus        90 ~~~~ii~v~nK~Dl~~~~~  108 (158)
T PRK15467         90 VSKRQIAVISKTDMPDADV  108 (158)
T ss_pred             CCCCeEEEEEccccCcccH
Confidence            4567899999999976443


No 12 
>PF12102 DUF3578:  Domain of unknown function (DUF3578);  InterPro: IPR021961  This presumed domain is functionally uncharacterised. This domain is found in bacteria and archaea. This domain is typically between 177 to 191 amino acids in length. ; PDB: 3SSD_B 3SSE_A 3SSC_B.
Probab=41.37  E-value=13  Score=29.27  Aligned_cols=18  Identities=28%  Similarity=0.734  Sum_probs=12.6

Q ss_pred             CCCCCCCCceEEEeccce
Q 036922           54 GPPKTADISWVALIGQSV   71 (135)
Q Consensus        54 G~~~~~~~pWVavInrSq   71 (135)
                      |.-.-+++||||+.++.+
T Consensus        50 G~G~wA~iPWIai~d~~i   67 (188)
T PF12102_consen   50 GQGNWAEIPWIAIFDKRI   67 (188)
T ss_dssp             ESSSEESSEEEEEE-T--
T ss_pred             CCCCccCCeEEEEEcccC
Confidence            444688999999998855


No 13 
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=40.12  E-value=16  Score=26.21  Aligned_cols=18  Identities=17%  Similarity=0.075  Sum_probs=14.7

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+.+.|=|+||+|+.++.
T Consensus        38 ~~~p~ilVlNKiDl~~~~   55 (157)
T cd01858          38 PHKHLIFVLNKCDLVPTW   55 (157)
T ss_pred             CCCCEEEEEEchhcCCHH
Confidence            457899999999997554


No 14 
>PF01465 GRIP:  GRIP domain;  InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi []. The GRIP domain contains a completely conserved tyrosine residue.; GO: 0005515 protein binding, 0000042 protein targeting to Golgi; PDB: 1R4A_H 1UPT_B.
Probab=39.77  E-value=15  Score=23.23  Aligned_cols=31  Identities=26%  Similarity=0.236  Sum_probs=20.6

Q ss_pred             HHHHHHhhhhcCCccc--chhHHHHHHHHHHHH
Q 036922           90 AESESLKSILTGAPQS--KLGRIALVDALAQQI  120 (135)
Q Consensus        90 ~E~E~f~s~~~g~~~s--klG~~~L~~~Lsk~i  120 (135)
                      .+.||||++.+.-+.+  .-++..|...|+.-|
T Consensus         3 ~~~eYLKNvl~~fl~~~~~~~~~~llpvi~tlL   35 (46)
T PF01465_consen    3 INLEYLKNVLLQFLESREPSEREQLLPVIATLL   35 (46)
T ss_dssp             HHHHHHHHHHHHHHTTSS---HHHHHHHHHHHT
T ss_pred             hhHHHHHHHHHHHhcCCchhhHHHHHHHHHHHH
Confidence            4689999999433333  348899998888655


No 15 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=37.57  E-value=22  Score=23.01  Aligned_cols=20  Identities=25%  Similarity=0.449  Sum_probs=16.5

Q ss_pred             cCceeeeeeehhhccccchh
Q 036922           22 QGTRTVGVISKIDQASADQK   41 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~   41 (135)
                      .+...|-|+||+|+......
T Consensus       103 ~~~~~ivv~nK~D~~~~~~~  122 (163)
T cd00880         103 RGKPVLLVLNKIDLLPEEEE  122 (163)
T ss_pred             cCCeEEEEEEccccCChhhH
Confidence            57789999999999876544


No 16 
>COG0523 Putative GTPases (G3E family) [General function prediction only]
Probab=37.43  E-value=28  Score=29.86  Aligned_cols=29  Identities=31%  Similarity=0.384  Sum_probs=21.8

Q ss_pred             eeeehhhccccchhHHHHHHHHHHhCCCCCC
Q 036922           28 GVISKIDQASADQKALAAVQALLLNQGPPKT   58 (135)
Q Consensus        28 GVitKiD~~~~~t~alaAv~alL~~qG~~~~   58 (135)
                      =||||+|+.+...  ++++++.|..-.|..+
T Consensus       150 ivlNK~Dlv~~~~--l~~l~~~l~~lnp~A~  178 (323)
T COG0523         150 IVLNKTDLVDAEE--LEALEARLRKLNPRAR  178 (323)
T ss_pred             EEEecccCCCHHH--HHHHHHHHHHhCCCCe
Confidence            4899999999984  7788877765555543


No 17 
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=36.64  E-value=41  Score=26.27  Aligned_cols=17  Identities=24%  Similarity=0.556  Sum_probs=13.0

Q ss_pred             ceeeeeeehhhccccch
Q 036922           24 TRTVGVISKIDQASADQ   40 (135)
Q Consensus        24 ~RTiGVitKiD~~~~~t   40 (135)
                      .+.|+|+||+|+.....
T Consensus       134 p~vi~VvnK~D~~~~~~  150 (225)
T cd01882         134 PRVMGVLTHLDLFKKNK  150 (225)
T ss_pred             CeEEEEEeccccCCcHH
Confidence            45789999999985443


No 18 
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=36.40  E-value=26  Score=31.99  Aligned_cols=19  Identities=26%  Similarity=0.613  Sum_probs=16.7

Q ss_pred             CCCCCCCCceEEEecccee
Q 036922           54 GPPKTADISWVALIGQSVS   72 (135)
Q Consensus        54 G~~~~~~~pWVavInrSq~   72 (135)
                      |.-.-.++||||+.|..|+
T Consensus        40 g~g~~a~vpw~a~~~~~~t   58 (459)
T PRK11331         40 GYGNFTSIPWFAFLGEGQE   58 (459)
T ss_pred             CCCCcccCceEEeecCCce
Confidence            6666789999999999997


No 19 
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=36.12  E-value=20  Score=26.01  Aligned_cols=18  Identities=22%  Similarity=0.357  Sum_probs=15.0

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+-+.+.|+||+|+++.+
T Consensus       128 ~~~pviiv~nK~D~~~~~  145 (179)
T TIGR03598       128 RGIPVLIVLTKADKLKKS  145 (179)
T ss_pred             cCCCEEEEEECcccCCHH
Confidence            577899999999998643


No 20 
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=35.97  E-value=21  Score=25.66  Aligned_cols=17  Identities=24%  Similarity=0.413  Sum_probs=14.7

Q ss_pred             cCceeeeeeehhhcccc
Q 036922           22 QGTRTVGVISKIDQASA   38 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~   38 (135)
                      .+.+.|-|+||+|+...
T Consensus        28 ~~~p~IiVlNK~Dl~~~   44 (155)
T cd01849          28 KGKKLILVLNKADLVPK   44 (155)
T ss_pred             CCCCEEEEEechhcCCH
Confidence            57899999999999754


No 21 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=33.50  E-value=26  Score=23.59  Aligned_cols=20  Identities=15%  Similarity=0.338  Sum_probs=16.4

Q ss_pred             cCceeeeeeehhhccccchh
Q 036922           22 QGTRTVGVISKIDQASADQK   41 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~   41 (135)
                      .+...|.|+||+|+......
T Consensus       104 ~~~piiiv~nK~D~~~~~~~  123 (157)
T cd01894         104 SKKPVILVVNKVDNIKEEDE  123 (157)
T ss_pred             cCCCEEEEEECcccCChHHH
Confidence            46889999999999876544


No 22 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=32.96  E-value=28  Score=23.36  Aligned_cols=18  Identities=17%  Similarity=0.174  Sum_probs=15.2

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+.+.|-|+||+|+++..
T Consensus       106 ~~~~vi~v~nK~D~~~~~  123 (157)
T cd04164         106 ADKPIIVVLNKSDLLPDS  123 (157)
T ss_pred             cCCCEEEEEEchhcCCcc
Confidence            578889999999998654


No 23 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=32.68  E-value=45  Score=26.31  Aligned_cols=29  Identities=31%  Similarity=0.428  Sum_probs=19.5

Q ss_pred             cCceeeeeeehhhccccc--hhHHHHHHHHH
Q 036922           22 QGTRTVGVISKIDQASAD--QKALAAVQALL   50 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~--t~alaAv~alL   50 (135)
                      .|-..|-|+||+|+...+  .+.+..+..+|
T Consensus       137 ~~ip~ivvvNK~D~~~~~~~~~~~~~l~~~L  167 (224)
T cd04165         137 LNIPVFVVVTKIDLAPANILQETLKDLKRIL  167 (224)
T ss_pred             cCCCEEEEEECccccCHHHHHHHHHHHHHHh
Confidence            577889999999997643  23344444444


No 24 
>PF10414 CysG_dimeriser:  Sirohaem synthase dimerisation region;  InterPro: IPR019478  Bacterial sulphur metabolism depends on the iron-containing porphinoid sirohaem. CysG is a multi-functional enzyme with S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase, dehydrogenase and ferrochelatase activities. CysG synthesizes sirohaem from uroporphyrinogen III via reactions which encompass two branchpoint intermediates in tetrapyrrole biosynthesis, diverting flux first from protoporphyrin IX biosynthesis and then from cobalamin (vitamin B12) biosynthesis. CysG is a dimer. Its dimerisation region is 74 residues long, and acts to hold the two structurally similar protomers held together asymmetrically through a number of salt-bridges across complementary residues within the dimerisation region []. CysG dimerisation produces a series of active sites, accounting for CysG's multi-functionality, catalysing four diverse reactions:   Two SAM-dependent methylations NAD+-dependent tetrapyrrole dehydrogenation Metal chelation  ; GO: 0006779 porphyrin-containing compound biosynthetic process, 0055114 oxidation-reduction process; PDB: 1PJT_A 1PJS_A 1PJQ_A.
Probab=32.43  E-value=38  Score=21.68  Aligned_cols=17  Identities=41%  Similarity=0.749  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHhhcccc
Q 036922          115 ALAQQIRKRMKVRVPNV  131 (135)
Q Consensus       115 ~Lsk~i~~~ik~RlP~i  131 (135)
                      .|+..+|.++|.+||..
T Consensus         8 ~l~~~~R~~Vk~~l~~~   24 (60)
T PF10414_consen    8 ELAGRFRERVKQRLPDF   24 (60)
T ss_dssp             HHHHHHHHHHHHH-SSH
T ss_pred             HHHHHHHHHHHHHCCCc
Confidence            47789999999999974


No 25 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=32.04  E-value=29  Score=23.56  Aligned_cols=18  Identities=28%  Similarity=0.327  Sum_probs=15.0

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+...|-|+||+|+.+..
T Consensus       100 ~~~~~iiv~NK~Dl~~~~  117 (158)
T cd01879         100 LGLPVVVALNMIDEAEKR  117 (158)
T ss_pred             cCCCEEEEEehhhhcccc
Confidence            567899999999997654


No 26 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=30.96  E-value=65  Score=21.77  Aligned_cols=30  Identities=23%  Similarity=0.305  Sum_probs=19.3

Q ss_pred             cCceeeeeeehhhccccchhHHHHHHHHHH
Q 036922           22 QGTRTVGVISKIDQASADQKALAAVQALLL   51 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~alaAv~alL~   51 (135)
                      .+...|-|+||+|+++......+.+...+.
T Consensus       112 ~~~~~iiv~nK~Dl~~~~~~~~~~~~~~~~  141 (174)
T cd01895         112 EGKALVIVVNKWDLVEKDSKTMKEFKKEIR  141 (174)
T ss_pred             cCCCEEEEEeccccCCccHHHHHHHHHHHH
Confidence            467788999999998774333333333343


No 27 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=29.88  E-value=57  Score=24.52  Aligned_cols=17  Identities=24%  Similarity=0.268  Sum_probs=14.2

Q ss_pred             cCceeeeeeehhhcccc
Q 036922           22 QGTRTVGVISKIDQASA   38 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~   38 (135)
                      .|.+.+=|+||+|+...
T Consensus       106 ~~~~~ilV~nK~D~~~~  122 (197)
T cd04104         106 MGKKFYFVRTKVDRDLS  122 (197)
T ss_pred             hCCCEEEEEecccchhh
Confidence            47889999999999654


No 28 
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=29.52  E-value=31  Score=26.28  Aligned_cols=19  Identities=26%  Similarity=0.366  Sum_probs=15.0

Q ss_pred             cCceeeeeeehhhccccch
Q 036922           22 QGTRTVGVISKIDQASADQ   40 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t   40 (135)
                      .+.+.|-||+|+|+.++..
T Consensus        29 ~~kp~IlVlNK~DL~~~~~   47 (172)
T cd04178          29 GNKKLVLVLNKIDLVPKEN   47 (172)
T ss_pred             CCCCEEEEEehhhcCCHHH
Confidence            3578899999999976543


No 29 
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=28.99  E-value=35  Score=25.20  Aligned_cols=18  Identities=28%  Similarity=0.211  Sum_probs=14.8

Q ss_pred             cCceeeeeeehhhccccc
Q 036922           22 QGTRTVGVISKIDQASAD   39 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~   39 (135)
                      .+.+.|-|+||+|+....
T Consensus        60 ~~~~~ilV~NK~Dl~~~~   77 (190)
T cd01855          60 GNNPVILVGNKIDLLPKD   77 (190)
T ss_pred             CCCcEEEEEEchhcCCCC
Confidence            567889999999997644


No 30 
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=28.96  E-value=1.2e+02  Score=20.76  Aligned_cols=19  Identities=21%  Similarity=0.347  Sum_probs=14.2

Q ss_pred             cCceeeeeeehhhccccch
Q 036922           22 QGTRTVGVISKIDQASADQ   40 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t   40 (135)
                      .+.+.|-|+||+|+.+...
T Consensus       101 ~~~p~ivv~NK~Dl~~~~~  119 (168)
T cd01887         101 ANVPFIVALNKIDKPNANP  119 (168)
T ss_pred             cCCCEEEEEEceecccccH
Confidence            5677888999999875443


No 31 
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pai
Probab=28.42  E-value=33  Score=21.88  Aligned_cols=14  Identities=14%  Similarity=0.299  Sum_probs=10.7

Q ss_pred             ceeeeeeehhhccc
Q 036922           24 TRTVGVISKIDQAS   37 (135)
Q Consensus        24 ~RTiGVitKiD~~~   37 (135)
                      .|.+||||+-|++.
T Consensus        99 ~~~~Gvvs~~dl~~  112 (113)
T cd04587          99 GQVVGLLDVTKLTH  112 (113)
T ss_pred             CCEEEEEEHHHhcc
Confidence            57788888888753


No 32 
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=28.12  E-value=77  Score=24.07  Aligned_cols=26  Identities=27%  Similarity=0.107  Sum_probs=16.4

Q ss_pred             eeeeeehhhccccchhHHHHHHHHHH
Q 036922           26 TVGVISKIDQASADQKALAAVQALLL   51 (135)
Q Consensus        26 TiGVitKiD~~~~~t~alaAv~alL~   51 (135)
                      .+-|+||+|+.......++.++..+.
T Consensus       151 ~iiv~NK~Dl~~~~~~~~~~~~~~l~  176 (207)
T TIGR00073       151 DLIVINKADLAEAVGFDVEKMKADAK  176 (207)
T ss_pred             CEEEEEHHHccccchhhHHHHHHHHH
Confidence            48999999998654333334444344


No 33 
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=27.18  E-value=44  Score=21.41  Aligned_cols=16  Identities=13%  Similarity=0.235  Sum_probs=13.1

Q ss_pred             cCceeeeeeehhhccc
Q 036922           22 QGTRTVGVISKIDQAS   37 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~   37 (135)
                      ++.+.+||||+-|+..
T Consensus        97 ~~g~~~Gvvt~~dl~~  112 (113)
T cd04615          97 DKGKVGGIVTEDDILR  112 (113)
T ss_pred             CCCeEEEEEEHHHhhc
Confidence            4569999999998864


No 34 
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only]
Probab=26.06  E-value=65  Score=29.29  Aligned_cols=36  Identities=22%  Similarity=0.307  Sum_probs=29.5

Q ss_pred             CCCCCCCCCceEEEeccceehhhcccCCCCcHHHHHHHHHHHHhhhh
Q 036922           53 QGPPKTADISWVALIGQSVSIATAQSGSESSLETAWRAESESLKSIL   99 (135)
Q Consensus        53 qG~~~~~~~pWVavInrSq~ia~Adinse~~m~tArr~E~E~f~s~~   99 (135)
                      =+|.....|||+++.|.+-           +--++||.|.-.|.+.+
T Consensus       127 vaP~I~~~IPwA~~lGNHD-----------des~ltr~ql~~~i~~l  162 (379)
T KOG1432|consen  127 VAPAIDRKIPWAAVLGNHD-----------DESDLTRLQLMKFISKL  162 (379)
T ss_pred             hhhHhhcCCCeEEEecccc-----------cccccCHHHHHHHHhcC
Confidence            3888899999999999765           34467899988888877


No 35 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=25.55  E-value=1.4e+02  Score=20.54  Aligned_cols=15  Identities=27%  Similarity=0.089  Sum_probs=8.3

Q ss_pred             Cceeeeeeehhhccc
Q 036922           23 GTRTVGVISKIDQAS   37 (135)
Q Consensus        23 g~RTiGVitKiD~~~   37 (135)
                      +-..+-|+||+|+..
T Consensus       109 ~~p~ilv~nK~Dl~~  123 (172)
T cd01862         109 NFPFVVLGNKIDLEE  123 (172)
T ss_pred             CceEEEEEECccccc
Confidence            344555666666653


No 36 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=25.16  E-value=78  Score=21.11  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=15.1

Q ss_pred             cCceeeeeeehhhccccchh
Q 036922           22 QGTRTVGVISKIDQASADQK   41 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~   41 (135)
                      -+...+-|+||+|++..+..
T Consensus       109 ~~~~vi~v~nK~D~~~~~~~  128 (170)
T cd01876         109 LGIPFLVVLTKADKLKKSEL  128 (170)
T ss_pred             cCCCEEEEEEchhcCChHHH
Confidence            35667889999999866543


No 37 
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzi
Probab=25.16  E-value=48  Score=20.97  Aligned_cols=16  Identities=25%  Similarity=0.351  Sum_probs=12.6

Q ss_pred             cCceeeeeeehhhccc
Q 036922           22 QGTRTVGVISKIDQAS   37 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~   37 (135)
                      +..+.+||||+-|+..
T Consensus        90 ~~~~~~Gvi~~~~l~~  105 (106)
T cd04582          90 EDGRYVGEVTQRSIAD  105 (106)
T ss_pred             CCCcEEEEEEHHHhhc
Confidence            3468999999998764


No 38 
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC.  SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus).  SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB.  It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase a
Probab=24.98  E-value=48  Score=21.00  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=11.6

Q ss_pred             Cceeeeeeehhhccc
Q 036922           23 GTRTVGVISKIDQAS   37 (135)
Q Consensus        23 g~RTiGVitKiD~~~   37 (135)
                      ..+.+||||+-|++.
T Consensus        99 ~~~~~Gvvt~~di~~  113 (114)
T cd04613          99 PGKLLGILSRSDLLS  113 (114)
T ss_pred             CCEEEEEEEhHHhhc
Confidence            468899999888753


No 39 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=23.38  E-value=2e+02  Score=21.09  Aligned_cols=29  Identities=31%  Similarity=0.461  Sum_probs=19.0

Q ss_pred             cCceeeeeeehhhccccchh-HHHHHHHHH
Q 036922           22 QGTRTVGVISKIDQASADQK-ALAAVQALL   50 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~-alaAv~alL   50 (135)
                      .+-+.|-|+||+|+...... .++.+..++
T Consensus       116 ~~~p~iiv~NK~Dl~~~~~~~~~~~~~~~~  145 (194)
T cd01891         116 LGLKPIVVINKIDRPDARPEEVVDEVFDLF  145 (194)
T ss_pred             cCCCEEEEEECCCCCCCCHHHHHHHHHHHH
Confidence            57788999999999755442 233444434


No 40 
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=23.28  E-value=76  Score=25.78  Aligned_cols=40  Identities=18%  Similarity=0.188  Sum_probs=26.3

Q ss_pred             cCceeeeeeehhhccccch-hHHHHHHHHHHhCCCCCCCCCce
Q 036922           22 QGTRTVGVISKIDQASADQ-KALAAVQALLLNQGPPKTADISW   63 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t-~alaAv~alL~~qG~~~~~~~pW   63 (135)
                      .+...|-|+||+|+...+. +.++.++..|.  -+....++||
T Consensus       122 ~~~P~iivvNK~D~~~a~~~~~~~~l~~~l~--~~~~~~~~Pi  162 (267)
T cd04169         122 RGIPIITFINKLDREGRDPLELLDEIEEELG--IDCTPLTWPI  162 (267)
T ss_pred             cCCCEEEEEECCccCCCCHHHHHHHHHHHHC--CCceeEEecc
Confidence            4778899999999876553 44455555442  3555666665


No 41 
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=23.07  E-value=72  Score=26.04  Aligned_cols=40  Identities=15%  Similarity=0.301  Sum_probs=24.4

Q ss_pred             cCceeeeeeehhhccccch-hHHHHHHHHHHhCCCCCCCCCce
Q 036922           22 QGTRTVGVISKIDQASADQ-KALAAVQALLLNQGPPKTADISW   63 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t-~alaAv~alL~~qG~~~~~~~pW   63 (135)
                      .|.+.|.||+|+|+...+. +.+..++..+.  -+.....+|+
T Consensus       115 ~~~p~ivviNK~D~~~a~~~~~~~~l~~~l~--~~~~~~~~Pi  155 (270)
T cd01886         115 YNVPRIAFVNKMDRTGADFFRVVEQIREKLG--ANPVPLQLPI  155 (270)
T ss_pred             cCCCEEEEEECCCCCCCCHHHHHHHHHHHhC--CCceEEEecc
Confidence            5778899999999975443 44455555442  2334444554


No 42 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=22.78  E-value=1.1e+02  Score=20.80  Aligned_cols=15  Identities=27%  Similarity=0.202  Sum_probs=12.3

Q ss_pred             Cceeeeeeehhhccc
Q 036922           23 GTRTVGVISKIDQAS   37 (135)
Q Consensus        23 g~RTiGVitKiD~~~   37 (135)
                      ..+.|.|.||.|+..
T Consensus       110 ~~piilv~nK~Dl~~  124 (168)
T cd04119         110 NIVVVVCANKIDLTK  124 (168)
T ss_pred             CceEEEEEEchhccc
Confidence            467899999999874


No 43 
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=22.34  E-value=55  Score=20.62  Aligned_cols=20  Identities=20%  Similarity=0.099  Sum_probs=16.9

Q ss_pred             cCceeeeeeehhhccccchh
Q 036922           22 QGTRTVGVISKIDQASADQK   41 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~~t~   41 (135)
                      .+...+.|+||+|+......
T Consensus       101 ~~~~~ivv~nk~D~~~~~~~  120 (157)
T cd00882         101 ENIPIILVGNKIDLPEERVV  120 (157)
T ss_pred             CCCcEEEEEeccccccccch
Confidence            68889999999999876554


No 44 
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=21.93  E-value=61  Score=20.91  Aligned_cols=17  Identities=29%  Similarity=0.292  Sum_probs=13.4

Q ss_pred             cCceeeeeeehhhcccc
Q 036922           22 QGTRTVGVISKIDQASA   38 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~   38 (135)
                      +..+.+||||+-|.+.+
T Consensus        97 ~~~~~~Gvit~~di~~~  113 (113)
T cd04607          97 EEGRVVGLATLDDLLSK  113 (113)
T ss_pred             CCCCEEEEEEhHHhccC
Confidence            45688999999998753


No 45 
>PRK05935 biotin--protein ligase; Provisional
Probab=21.71  E-value=89  Score=24.72  Aligned_cols=27  Identities=15%  Similarity=0.274  Sum_probs=24.5

Q ss_pred             chhHHHHHHHHHHHHHHHHHhhccccc
Q 036922          106 KLGRIALVDALAQQIRKRMKVRVPNVL  132 (135)
Q Consensus       106 klG~~~L~~~Lsk~i~~~ik~RlP~il  132 (135)
                      ...+..|...|.++|.++++.|||-++
T Consensus       157 ~~~~~~l~~~l~~~l~~~~~~~~~~~~  183 (190)
T PRK05935        157 PIDLEEQRERLIKHIKHVLIQTLPKLL  183 (190)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            467899999999999999999999875


No 46 
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain. Met2 is a key enzyme in the biosynthesis of methionine.  It encodes a homoserine transacetylase involved in converting homoserine to O-acetyl homoserine. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=21.25  E-value=55  Score=20.84  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=9.0

Q ss_pred             cCceeeeeeehhhcc
Q 036922           22 QGTRTVGVISKIDQA   36 (135)
Q Consensus        22 ~g~RTiGVitKiD~~   36 (135)
                      ++.+.+||||+-|+.
T Consensus        94 ~~~~~~G~v~~~di~  108 (110)
T cd04605          94 AENRVIGIITSEDIS  108 (110)
T ss_pred             CCCcEEEEEEHHHhh
Confidence            345666777666653


No 47 
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=20.88  E-value=74  Score=24.67  Aligned_cols=12  Identities=50%  Similarity=0.504  Sum_probs=10.3

Q ss_pred             eeeeehhhcccc
Q 036922           27 VGVISKIDQASA   38 (135)
Q Consensus        27 iGVitKiD~~~~   38 (135)
                      +.|+||+|+.+.
T Consensus       141 ~~~~~k~d~~~~  152 (199)
T TIGR00101       141 LLVINKIDLAPM  152 (199)
T ss_pred             EEEEEhhhcccc
Confidence            789999999854


No 48 
>COG1162 Predicted GTPases [General function prediction only]
Probab=20.72  E-value=90  Score=27.16  Aligned_cols=36  Identities=25%  Similarity=0.279  Sum_probs=24.4

Q ss_pred             cccccc--cCceeeeeeehhhccccchhHHHHHHHHHH
Q 036922           16 RVLSFL--QGTRTVGVISKIDQASADQKALAAVQALLL   51 (135)
Q Consensus        16 ~alkla--~g~RTiGVitKiD~~~~~t~alaAv~alL~   51 (135)
                      |.|=+|  .|-.-|=||||+|+.+.......+...+.+
T Consensus       101 R~Lv~ae~~gi~pvIvlnK~DL~~~~~~~~~~~~~~y~  138 (301)
T COG1162         101 RYLVLAEAGGIEPVIVLNKIDLLDDEEAAVKELLREYE  138 (301)
T ss_pred             HHHHHHHHcCCcEEEEEEccccCcchHHHHHHHHHHHH
Confidence            344444  788889999999999988875433333343


No 49 
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=20.64  E-value=57  Score=20.80  Aligned_cols=13  Identities=23%  Similarity=0.388  Sum_probs=9.2

Q ss_pred             ceeeeeeehhhcc
Q 036922           24 TRTVGVISKIDQA   36 (135)
Q Consensus        24 ~RTiGVitKiD~~   36 (135)
                      .+.+||||+-|+.
T Consensus        97 ~~~~G~it~~dl~  109 (111)
T cd04639          97 GRLVGLVTLENVG  109 (111)
T ss_pred             CCEEEEEEHHHhh
Confidence            5677888777764


No 50 
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS do
Probab=20.59  E-value=56  Score=20.99  Aligned_cols=15  Identities=7%  Similarity=0.102  Sum_probs=10.5

Q ss_pred             cCceeeeeeehhhcc
Q 036922           22 QGTRTVGVISKIDQA   36 (135)
Q Consensus        22 ~g~RTiGVitKiD~~   36 (135)
                      +..+.+||||+-|+.
T Consensus        88 ~~~~~iGvit~~dl~  102 (104)
T cd04594          88 DDGKFKGIVTLDSIL  102 (104)
T ss_pred             ECCEEEEEEEHHHhh
Confidence            445778888877764


No 51 
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other divalent cations into the cell via two highly conserved aspartates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=20.30  E-value=66  Score=20.69  Aligned_cols=16  Identities=31%  Similarity=0.401  Sum_probs=13.0

Q ss_pred             cCceeeeeeehhhccc
Q 036922           22 QGTRTVGVISKIDQAS   37 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~   37 (135)
                      +..+.+||||+-|++.
T Consensus        92 ~~~~~~Gvit~~dll~  107 (109)
T cd04606          92 EEGRLVGIITVDDVID  107 (109)
T ss_pred             CCCcEEEEEEhHHhhh
Confidence            4568999999999863


No 52 
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=20.21  E-value=59  Score=20.71  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=11.1

Q ss_pred             cCceeeeeeehhhccc
Q 036922           22 QGTRTVGVISKIDQAS   37 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~   37 (135)
                      +..+.+|+||+-|...
T Consensus        90 d~~~~~G~it~~d~~~  105 (106)
T cd04638          90 DDGKLVGIVTVADIVR  105 (106)
T ss_pred             ECCEEEEEEEHHHhhc
Confidence            3347888888877653


No 53 
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=20.07  E-value=63  Score=23.65  Aligned_cols=17  Identities=24%  Similarity=0.253  Sum_probs=14.1

Q ss_pred             cCceeeeeeehhhcccc
Q 036922           22 QGTRTVGVISKIDQASA   38 (135)
Q Consensus        22 ~g~RTiGVitKiD~~~~   38 (135)
                      .+...|=|+||+|+.+.
T Consensus        45 ~~k~~ilVlNK~Dl~~~   61 (171)
T cd01856          45 GNKPRIIVLNKADLADP   61 (171)
T ss_pred             cCCCEEEEEehhhcCCh
Confidence            46789999999999754


Done!