Citrus Sinensis ID: 036943

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MSSRDRDPLILGRVVGDVLDNFTRTIPMRITYLNKDVNNGRELKPSEVLNQPRVEIGGDDLRTFYTLVMVDPDAPSP
ccccccccEEccccccccccccccccEEEEEEccCEEccccCCcccccccccEEEEccccccccEEEEEEccccccc
*****RD*LILGRVVGDVLDNFTRTIPMRITYLNKDVNNGRELKPSEVLNQPRVEIGGDDLRTFYTLVMVDPDAP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRDRDPLILGRVVGDVLDNFTRTIPMRITYLNKDVNNGRELKPSEVLNQPRVEIGGDDLRTFYTLVMVDPDAPSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein HEADING DATE 3A Probable mobile flower-promoting signal (florigen) that moves from the leaf to the shoot apical meristem (SAM) and induces flowering. Promotes the transition from vegetative growth to flowering downstream of HD1 and EHD1 under short day (SD) conditions. Acts upstream of MADS14 and MADS15.probableQ93WI9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WKO, chain A
Confidence level:very confident
Coverage over the Query: 4-77
View the alignment between query and template
View the model in PyMOL