BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 036974
         (522 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GT5|A Chain A, Crystal Structure Of An N-Acetylglucosamine 2-Epimerase
           Family Protein From Xylella Fastidiosa
          Length = 402

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 130 WTLLEDNLLNDFDHCYGIVLIV-GYVPGLKVETIPLLRSKEEPEFSMVDKFLMD 182
           WTL +D + +D +HCYG+  ++  Y  GLKV  I   R   +  + ++++   D
Sbjct: 98  WTLCDDRVEDDTNHCYGLAFVMLAYSCGLKV-GIKQAREWMDETWCLLERHFWD 150


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.140    0.422 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,589,632
Number of Sequences: 62578
Number of extensions: 582375
Number of successful extensions: 1209
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1207
Number of HSP's gapped (non-prelim): 2
length of query: 522
length of database: 14,973,337
effective HSP length: 103
effective length of query: 419
effective length of database: 8,527,803
effective search space: 3573149457
effective search space used: 3573149457
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)