Query         036986
Match_columns 178
No_of_seqs    145 out of 678
Neff          5.2 
Searched_HMMs 46136
Date          Fri Mar 29 07:26:38 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036986.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036986hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist 100.0 1.1E-54 2.3E-59  390.1  14.0  133   41-177    47-182 (387)
  2 PF14416 PMR5N:  PMR5 N termina  99.9 6.6E-27 1.4E-31  158.9   4.7   54   44-101     1-55  (55)
  3 PF13839 PC-Esterase:  GDSL/SGN  99.7 8.9E-18 1.9E-22  138.3   7.5   75  102-176     1-81  (263)
  4 cd01842 SGNH_hydrolase_like_5   89.7    0.26 5.6E-06   41.1   2.4   23  119-141     2-24  (183)
  5 cd01829 SGNH_hydrolase_peri2 S  84.9     0.8 1.7E-05   36.0   2.6   22  118-139     1-22  (200)
  6 COG2845 Uncharacterized protei  84.8       1 2.3E-05   40.9   3.6   30  111-140   111-140 (354)
  7 cd01834 SGNH_hydrolase_like_2   84.7    0.49 1.1E-05   36.5   1.3   15  116-130     1-15  (191)
  8 cd01841 NnaC_like NnaC (CMP-Ne  82.9    0.61 1.3E-05   36.0   1.1   15  117-131     1-15  (174)
  9 cd01825 SGNH_hydrolase_peri1 S  74.5     1.4   3E-05   34.1   0.8   18  118-135     1-19  (189)
 10 cd01838 Isoamyl_acetate_hydrol  71.5     1.8 3.9E-05   33.5   0.9   13  118-130     1-13  (199)
 11 cd01844 SGNH_hydrolase_like_6   71.5     2.1 4.5E-05   33.5   1.2   13  118-130     1-13  (177)
 12 cd01835 SGNH_hydrolase_like_3   70.3       2 4.3E-05   33.8   0.8   13  117-129     2-14  (193)
 13 PF00185 OTCace:  Aspartate/orn  69.9     3.6 7.9E-05   32.7   2.3   25  115-140     1-25  (158)
 14 cd01820 PAF_acetylesterase_lik  68.6     3.9 8.5E-05   33.1   2.2   16  115-130    31-46  (214)
 15 cd01832 SGNH_hydrolase_like_1   68.1     2.2 4.8E-05   33.0   0.7   11  118-128     1-11  (185)
 16 cd01827 sialate_O-acetylestera  64.9     3.3 7.2E-05   32.2   1.1   13  118-130     2-14  (188)
 17 cd01822 Lysophospholipase_L1_l  64.1     3.4 7.4E-05   31.5   1.0   12  118-129     2-13  (177)
 18 cd01831 Endoglucanase_E_like E  63.4     3.7 8.1E-05   31.8   1.1   15  118-132     1-15  (169)
 19 PRK10528 multifunctional acyl-  63.2       4 8.7E-05   32.7   1.3   15  116-130    10-24  (191)
 20 cd01833 XynB_like SGNH_hydrola  62.9     2.9 6.2E-05   31.6   0.4   12  118-129     2-13  (157)
 21 COG0034 PurF Glutamine phospho  61.9     7.7 0.00017   36.7   3.1   33  110-142   342-375 (470)
 22 cd00229 SGNH_hydrolase SGNH_hy  58.7     3.6 7.8E-05   29.8   0.3   14  119-132     1-14  (187)
 23 PF09949 DUF2183:  Uncharacteri  57.7     9.2  0.0002   28.6   2.4   23  107-129    55-77  (100)
 24 PF12026 DUF3513:  Domain of un  57.6    0.61 1.3E-05   39.6  -4.5   17  114-130   132-148 (210)
 25 cd01836 FeeA_FeeB_like SGNH_hy  56.0       6 0.00013   30.9   1.2   14  117-130     3-16  (191)
 26 cd04501 SGNH_hydrolase_like_4   55.6       6 0.00013   30.6   1.1   12  117-128     1-12  (183)
 27 cd01839 SGNH_arylesterase_like  55.1     6.4 0.00014   31.4   1.2   12  118-129     1-12  (208)
 28 PRK14805 ornithine carbamoyltr  54.7       9  0.0002   33.9   2.2   27  112-140   143-169 (302)
 29 cd01830 XynE_like SGNH_hydrola  54.6     6.5 0.00014   31.4   1.2   12  118-129     1-12  (204)
 30 cd01828 sialate_O-acetylestera  53.4       6 0.00013   30.3   0.8   13  119-131     2-14  (169)
 31 PRK04284 ornithine carbamoyltr  50.2      13 0.00028   33.3   2.5   27  113-140   152-178 (332)
 32 cd01821 Rhamnogalacturan_acety  50.0     8.5 0.00018   30.4   1.2   14  118-131     2-15  (198)
 33 cd04502 SGNH_hydrolase_like_7   47.8     9.1  0.0002   29.4   1.0   13  119-131     2-14  (171)
 34 PRK00856 pyrB aspartate carbam  44.8      18 0.00038   32.1   2.4   29  112-140   152-180 (305)
 35 PLN02527 aspartate carbamoyltr  43.9      19 0.00041   31.8   2.5   27  113-139   148-174 (306)
 36 cd04506 SGNH_hydrolase_YpmR_li  43.2      12 0.00026   29.5   1.1   12  118-129     1-12  (204)
 37 PRK02102 ornithine carbamoyltr  43.1      20 0.00044   32.2   2.6   27  113-140   152-178 (331)
 38 PF00702 Hydrolase:  haloacid d  42.9      21 0.00045   27.8   2.4   20  108-127   185-206 (215)
 39 TIGR01489 DKMTPPase-SF 2,3-dik  40.6      31 0.00066   26.5   3.0   13  116-128   162-174 (188)
 40 PRK01713 ornithine carbamoyltr  40.3      23  0.0005   31.7   2.5   26  114-140   154-179 (334)
 41 cd01840 SGNH_hydrolase_yrhL_li  40.3      21 0.00046   27.2   2.0   20  119-138     2-21  (150)
 42 PLN02342 ornithine carbamoyltr  40.1      23 0.00051   32.1   2.5   26  113-140   191-216 (348)
 43 PF04954 SIP:  Siderophore-inte  40.0      60  0.0013   24.3   4.4   24  117-140     2-25  (119)
 44 PF01861 DUF43:  Protein of unk  38.2      15 0.00033   32.0   0.9   12  114-125    43-54  (243)
 45 COG0078 ArgF Ornithine carbamo  38.1      24 0.00053   31.8   2.3   21  114-136   151-171 (310)
 46 PRK08192 aspartate carbamoyltr  37.6      25 0.00055   31.6   2.3   26  114-139   157-182 (338)
 47 CHL00073 chlN photochlorophyll  35.6      44 0.00096   31.5   3.7   29  109-140   307-335 (457)
 48 TIGR00670 asp_carb_tr aspartat  35.5      23 0.00051   31.2   1.7   29  112-140   146-174 (301)
 49 KOG0572 Glutamine phosphoribos  35.0      37  0.0008   32.0   2.9   33  111-143   351-384 (474)
 50 PRK12562 ornithine carbamoyltr  34.2      33 0.00072   30.9   2.5   26  114-140   154-179 (334)
 51 PRK11891 aspartate carbamoyltr  34.1      33 0.00072   32.1   2.6   26  114-139   239-264 (429)
 52 COG0540 PyrB Aspartate carbamo  32.3      15 0.00033   33.2   0.0   45   96-140   138-182 (316)
 53 PF00657 Lipase_GDSL:  GDSL-lik  30.8      25 0.00054   27.3   1.1   11  119-129     1-11  (234)
 54 PRK03515 ornithine carbamoyltr  30.3      42 0.00092   30.2   2.5   26  114-140   154-179 (336)
 55 PRK14804 ornithine carbamoyltr  30.0      41  0.0009   29.8   2.4   26  113-140   150-175 (311)
 56 PRK00779 ornithine carbamoyltr  29.6      30 0.00064   30.6   1.4   42   97-140   133-174 (304)
 57 PF13242 Hydrolase_like:  HAD-h  29.4      56  0.0012   22.0   2.5   20  115-134    20-39  (75)
 58 TIGR00658 orni_carb_tr ornithi  28.6      46   0.001   29.3   2.4   25  114-140   146-170 (304)
 59 PF13086 AAA_11:  AAA domain; P  28.6      52  0.0011   25.6   2.5   16  110-125   210-226 (236)
 60 cd01823 SEST_like SEST_like. A  27.9      30 0.00065   28.4   1.1   13  118-130     2-14  (259)
 61 PF03193 DUF258:  Protein of un  26.6      57  0.0012   26.4   2.4   34  105-140    24-57  (161)
 62 PF12710 HAD:  haloacid dehalog  25.6      51  0.0011   25.3   2.0   13  115-127   174-186 (192)
 63 TIGR03333 salvage_mtnX 2-hydro  25.4      54  0.0012   26.5   2.2   14  115-128   155-168 (214)
 64 PRK10113 cell division modulat  25.4      36 0.00077   24.5   0.9   17  113-129    38-56  (80)
 65 PRK02255 putrescine carbamoylt  25.1      62  0.0013   29.1   2.6   24  114-139   152-175 (338)
 66 PF13289 SIR2_2:  SIR2-like dom  25.0 1.5E+02  0.0032   21.7   4.3   32  109-140    79-110 (143)
 67 PF13419 HAD_2:  Haloacid dehal  24.1      75  0.0016   23.3   2.6   15  115-130   149-163 (176)
 68 PLN02954 phosphoserine phospha  24.0      66  0.0014   25.7   2.4   13  116-128   169-181 (224)
 69 PRK13814 pyrB aspartate carbam  23.5      48   0.001   29.5   1.6   29  112-140   153-181 (310)
 70 PF14647 FAM91_N:  FAM91 N-term  23.2      91   0.002   28.2   3.3   30  102-141   109-138 (308)
 71 PF09084 NMT1:  NMT1/THI5 like;  21.7      69  0.0015   25.2   2.1   25  112-136    89-113 (216)
 72 PHA02597 30.2 hypothetical pro  21.0      69  0.0015   25.2   1.9   23  106-128   132-157 (197)
 73 COG0546 Gph Predicted phosphat  20.3      82  0.0018   25.7   2.3   17  112-128   156-174 (220)
 74 PRK13376 pyrB bifunctional asp  20.0      81  0.0018   30.3   2.5   26  114-139   172-197 (525)
 75 KOG3482 Small nuclear ribonucl  20.0      94   0.002   22.6   2.2   21  100-120     2-22  (79)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=100.00  E-value=1.1e-54  Score=390.11  Aligned_cols=133  Identities=30%  Similarity=0.656  Sum_probs=122.2

Q ss_pred             CCCCCCCccccCceeecCCCCCCCCCCC-CCc-CcccccccccCCCCCCCCcceeeeeCCCCCCCCCChHHHHHHhcCCc
Q 036986           41 SFHSTPCNLFSGKWVLQHPSTHKSLYNE-TCP-FQRNAWNCLRNQRPNMGTINSYKWVPETCDLPRINPVKFLSLMRNKN  118 (178)
Q Consensus        41 ~~~~~~Cd~f~G~WV~d~~~~~~P~Y~~-tCp-~i~~~~~C~~nGRpD~~~~~~wrWqP~~C~lp~fd~~~fl~~lrgKr  118 (178)
                      ..+.+.||+|+|+||+|   +++|+|++ +|| ||+++|||++|||||++|+ +|||||++|+|||||+.+||+.|||||
T Consensus        47 ~~~~~~CD~f~G~WV~D---~s~PlY~~~~Cp~fi~~~~nC~knGRPD~~Yl-~WRWqP~gC~LPRFda~~fLe~~RgKr  122 (387)
T PLN02629         47 QANQSTCALFVGTWVRD---DSYPLYQSSDCPGVIDPEFNCQMYGRPDSDYL-KYRWQPLNCELPRFNGLEFLLKMKGKT  122 (387)
T ss_pred             CCCccccCCCCCeEecC---CCCCCCCCCCCccccccccchhhcCCCCcchh-hccccCCCCCCCCcCHHHHHHHhcCCe
Confidence            35678899999999999   47899985 999 9999999999999999999 699999999999999999999999999


Q ss_pred             EEEEecchhhHHHHHHHHhhhhcccCCc-eeeecCceeeeEEcccceEEEEEecccceec
Q 036986          119 IGFVGDSLNENFIVSFLCVLRAADSGAK-KWKRKGAWRGGYFPKFNVTVAYHRAVLLANY  177 (178)
Q Consensus       119 ivFVGDSl~Rn~~~SL~clL~~~~~~~~-~~~~~~~~~~~~f~~~n~tv~f~WsPfLv~~  177 (178)
                      ||||||||+|||||||+|||++++|... ...++++++.|+|++||+||+||||||||+.
T Consensus       123 l~FVGDSL~RNQ~eSLvClL~~~~p~~~~~~~~~~~~~~~~F~~yN~TV~~ywspfLV~~  182 (387)
T PLN02629        123 VMFVGDSLGRNQWESLICLISSSVPSTRTQMSRGDPLSTFKFLDYGVSISFYKAPYLVDI  182 (387)
T ss_pred             EEEeccccchhHHHHHHHHhhccCCCCceeeecCCceEEEEeccCCEEEEEEecceEEee
Confidence            9999999999999999999999887553 3455667789999999999999999999985


No 2  
>PF14416 PMR5N:  PMR5 N terminal Domain
Probab=99.93  E-value=6.6e-27  Score=158.89  Aligned_cols=54  Identities=37%  Similarity=1.013  Sum_probs=49.8

Q ss_pred             CCCCccccCceeecCCCCCCCCCC-CCCcCcccccccccCCCCCCCCcceeeeeCCCCC
Q 036986           44 STPCNLFSGKWVLQHPSTHKSLYN-ETCPFQRNAWNCLRNQRPNMGTINSYKWVPETCD  101 (178)
Q Consensus        44 ~~~Cd~f~G~WV~d~~~~~~P~Y~-~tCp~i~~~~~C~~nGRpD~~~~~~wrWqP~~C~  101 (178)
                      +++||+|+|+||+|   .++|+|+ ++||||+++|||++|||||++|+ +|||||++|+
T Consensus         1 e~~Cd~~~G~WV~D---~~~PlY~~~~Cp~i~~~~nC~~nGRpD~~y~-~wRWqP~~Cd   55 (55)
T PF14416_consen    1 EKRCDYFDGRWVPD---PSYPLYTNSTCPFIDEGFNCQKNGRPDSDYL-KWRWQPRGCD   55 (55)
T ss_pred             CCccCcccCEEEeC---CCCCccCCCCCCcCCCccchhhcCCCCCccc-eeeecCCCCC
Confidence            36799999999999   4679997 69999999999999999999999 6999999996


No 3  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=99.72  E-value=8.9e-18  Score=138.29  Aligned_cols=75  Identities=28%  Similarity=0.395  Sum_probs=61.8

Q ss_pred             CCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhhccc-----CCce-eeecCceeeeEEcccceEEEEEecccce
Q 036986          102 LPRINPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRAADS-----GAKK-WKRKGAWRGGYFPKFNVTVAYHRAVLLA  175 (178)
Q Consensus       102 lp~fd~~~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~~~~-----~~~~-~~~~~~~~~~~f~~~n~tv~f~WsPfLv  175 (178)
                      |++||+.++|++||||+|+|||||++||+|+||+|+|.+..+     .... ....+....+.+.++|+||+|+|+|||+
T Consensus         1 ~~~~d~~~cL~~lr~k~i~fiGDS~~Rq~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~p~l~   80 (263)
T PF13839_consen    1 LPRFDARECLQRLRNKRIVFIGDSTTRQQYESLVCLLGPEVPSWQESPHSGIEFPNHRNFRYNFPDYNVTLSFYWDPFLV   80 (263)
T ss_pred             CChhhHHHHHHHccCCEEEEEechhhHHHHHHHHHHHhccccccccccccccccccCCceEEeecCCCeEEEEecccccc
Confidence            578999999999999999999999999999999999998765     2111 1122334567789999999999999998


Q ss_pred             e
Q 036986          176 N  176 (178)
Q Consensus       176 ~  176 (178)
                      +
T Consensus        81 ~   81 (263)
T PF13839_consen   81 D   81 (263)
T ss_pred             c
Confidence            4


No 4  
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=89.68  E-value=0.26  Score=41.13  Aligned_cols=23  Identities=17%  Similarity=0.390  Sum_probs=21.4

Q ss_pred             EEEEecchhhHHHHHHHHhhhhc
Q 036986          119 IGFVGDSLNENFIVSFLCVLRAA  141 (178)
Q Consensus       119 ivFVGDSl~Rn~~~SL~clL~~~  141 (178)
                      ++|+|||+.|-+|--|+|+|...
T Consensus         2 v~~lgds~~ravykdlv~l~q~~   24 (183)
T cd01842           2 VVILGDSIQRAVYKDLVLLLQKD   24 (183)
T ss_pred             EEEEccHHHHHHHHHHHHHhcCC
Confidence            78999999999999999999864


No 5  
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=84.90  E-value=0.8  Score=36.04  Aligned_cols=22  Identities=27%  Similarity=0.434  Sum_probs=18.2

Q ss_pred             cEEEEecchhhHHHHHHHHhhh
Q 036986          118 NIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       118 rivFVGDSl~Rn~~~SL~clL~  139 (178)
                      ||+|+|||++.+.+.++...+.
T Consensus         1 ril~iGDS~~~g~~~~l~~~~~   22 (200)
T cd01829           1 RVLVIGDSLAQGLAPGLLRALA   22 (200)
T ss_pred             CEEEEechHHHHHHHHHHHHhc
Confidence            6899999999998877775554


No 6  
>COG2845 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=84.79  E-value=1  Score=40.87  Aligned_cols=30  Identities=20%  Similarity=0.162  Sum_probs=24.5

Q ss_pred             HHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          111 LSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       111 l~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.=.+++|.|||||+++.+-+.|...|..
T Consensus       111 ~k~~~a~kvLvvGDslm~gla~gl~~al~t  140 (354)
T COG2845         111 AKSRDADKVLVVGDSLMQGLAEGLDKALAT  140 (354)
T ss_pred             hhCCCCCEEEEechHHhhhhHHHHHHHhcc
Confidence            344458999999999999999888887764


No 7  
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=84.72  E-value=0.49  Score=36.47  Aligned_cols=15  Identities=27%  Similarity=0.536  Sum_probs=14.0

Q ss_pred             CCcEEEEecchhhHH
Q 036986          116 NKNIGFVGDSLNENF  130 (178)
Q Consensus       116 gKrivFVGDSl~Rn~  130 (178)
                      |++|+|+|||++.+.
T Consensus         1 ~~~v~~~GDSit~g~   15 (191)
T cd01834           1 GDRIVFIGNSITDRG   15 (191)
T ss_pred             CCEEEEeCCChhhcc
Confidence            799999999999977


No 8  
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=82.90  E-value=0.61  Score=36.01  Aligned_cols=15  Identities=60%  Similarity=0.826  Sum_probs=12.7

Q ss_pred             CcEEEEecchhhHHH
Q 036986          117 KNIGFVGDSLNENFI  131 (178)
Q Consensus       117 KrivFVGDSl~Rn~~  131 (178)
                      |+|+|+|||++...-
T Consensus         1 ~~iv~~GdS~t~~~~   15 (174)
T cd01841           1 KNIVFIGDSLFEGWP   15 (174)
T ss_pred             CCEEEEcchhhhcCc
Confidence            689999999997653


No 9  
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=74.48  E-value=1.4  Score=34.09  Aligned_cols=18  Identities=33%  Similarity=0.479  Sum_probs=13.0

Q ss_pred             cEEEEecchhhH-HHHHHH
Q 036986          118 NIGFVGDSLNEN-FIVSFL  135 (178)
Q Consensus       118 rivFVGDSl~Rn-~~~SL~  135 (178)
                      ||+|+|||++-. .|-+.+
T Consensus         1 ~iv~~GDS~t~g~~~~~~l   19 (189)
T cd01825           1 RIAQLGDSHIAGDFFTDVL   19 (189)
T ss_pred             CeeEecCccccccchhhHH
Confidence            799999999963 344433


No 10 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=71.55  E-value=1.8  Score=33.48  Aligned_cols=13  Identities=31%  Similarity=0.417  Sum_probs=11.3

Q ss_pred             cEEEEecchhhHH
Q 036986          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 rivFVGDSl~Rn~  130 (178)
                      ||+|+|||++...
T Consensus         1 ~i~~~GDSit~g~   13 (199)
T cd01838           1 KIVLFGDSITQFS   13 (199)
T ss_pred             CEEEecCcccccc
Confidence            6999999999863


No 11 
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=71.48  E-value=2.1  Score=33.45  Aligned_cols=13  Identities=23%  Similarity=0.314  Sum_probs=11.4

Q ss_pred             cEEEEecchhhHH
Q 036986          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 rivFVGDSl~Rn~  130 (178)
                      ||+|+|||++.+.
T Consensus         1 ~iv~~GDSit~G~   13 (177)
T cd01844           1 PWVFYGTSISQGA   13 (177)
T ss_pred             CEEEEeCchhcCc
Confidence            6999999999865


No 12 
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=70.26  E-value=2  Score=33.77  Aligned_cols=13  Identities=46%  Similarity=0.470  Sum_probs=11.7

Q ss_pred             CcEEEEecchhhH
Q 036986          117 KNIGFVGDSLNEN  129 (178)
Q Consensus       117 KrivFVGDSl~Rn  129 (178)
                      ++|+|+|||++..
T Consensus         2 ~~i~~lGDSit~G   14 (193)
T cd01835           2 KRLIVVGDSLVYG   14 (193)
T ss_pred             cEEEEEcCccccC
Confidence            6899999999975


No 13 
>PF00185 OTCace:  Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain;  InterPro: IPR006131 This family contains two related enzymes:  Aspartate carbamoyltransferase (2.1.3.2 from EC) (ATCase) catalyzes the conversion of aspartate and carbamoyl phosphate to carbamoylaspartate, the second step in the de novo biosynthesis of pyrimidine nucleotides []. In prokaryotes ATCase consists of two subunits: a catalytic chain (gene pyrB) and a regulatory chain (gene pyrI), while in eukaryotes it is a domain in a multi- functional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals []) that also catalyzes other steps of the biosynthesis of pyrimidines. Ornithine carbamoyltransferase (2.1.3.3 from EC) (OTCase) catalyzes the conversion of ornithine and carbamoyl phosphate to citrulline. In mammals this enzyme participates in the urea cycle [] and is located in the mitochondrial matrix. In prokaryotes and eukaryotic microorganisms it is involved in the biosynthesis of arginine. In some bacterial species it is also involved in the degradation of arginine [] (the arginine deaminase pathway).  It has been shown [] that these two enzymes are evolutionary related. The predicted secondary structure of both enzymes are similar and there are some regions of sequence similarities. One of these regions includes three residues which have been shown, by crystallographic studies [], to be implicated in binding the phosphoryl group of carbamoyl phosphate and is described by IPR006132 from INTERPRO. The carboxyl-terminal, aspartate/ornithine-binding domain is connected to the amino-terminal domain by two alpha-helices, which comprise a hinge between domains [].; GO: 0016597 amino acid binding, 0016743 carboxyl- or carbamoyltransferase activity, 0006520 cellular amino acid metabolic process; PDB: 1ML4_A 4EP1_B 3Q98_A 3E2P_A 2RGW_E 4EKN_B 2G7M_E 3D6N_B 3M4J_A 3L06_A ....
Probab=69.86  E-value=3.6  Score=32.66  Aligned_cols=25  Identities=24%  Similarity=0.404  Sum_probs=21.2

Q ss_pred             cCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          115 RNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       115 rgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .|++|+|||| ..-|...|++.++..
T Consensus         1 ~gl~i~~vGD-~~~rv~~Sl~~~~~~   25 (158)
T PF00185_consen    1 KGLKIAYVGD-GHNRVAHSLIELLAK   25 (158)
T ss_dssp             TTEEEEEESS-TTSHHHHHHHHHHHH
T ss_pred             CCCEEEEECC-CCChHHHHHHHHHHH
Confidence            4899999999 667889999988775


No 14 
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=68.56  E-value=3.9  Score=33.05  Aligned_cols=16  Identities=31%  Similarity=0.854  Sum_probs=13.2

Q ss_pred             cCCcEEEEecchhhHH
Q 036986          115 RNKNIGFVGDSLNENF  130 (178)
Q Consensus       115 rgKrivFVGDSl~Rn~  130 (178)
                      ...+|+|+|||++...
T Consensus        31 ~~~~iv~lGDSit~g~   46 (214)
T cd01820          31 KEPDVVFIGDSITQNW   46 (214)
T ss_pred             CCCCEEEECchHhhhh
Confidence            3458999999999974


No 15 
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=68.12  E-value=2.2  Score=33.00  Aligned_cols=11  Identities=36%  Similarity=0.492  Sum_probs=10.0

Q ss_pred             cEEEEecchhh
Q 036986          118 NIGFVGDSLNE  128 (178)
Q Consensus       118 rivFVGDSl~R  128 (178)
                      ||+|+|||++.
T Consensus         1 ~i~~~GDSit~   11 (185)
T cd01832           1 RYVALGDSITE   11 (185)
T ss_pred             CeeEecchhhc
Confidence            69999999996


No 16 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=64.91  E-value=3.3  Score=32.16  Aligned_cols=13  Identities=31%  Similarity=0.590  Sum_probs=10.7

Q ss_pred             cEEEEecchhhHH
Q 036986          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 rivFVGDSl~Rn~  130 (178)
                      ||+|+|||++...
T Consensus         2 ~i~~~GDSit~G~   14 (188)
T cd01827           2 KVACVGNSITEGA   14 (188)
T ss_pred             eEEEEeccccccc
Confidence            7999999996654


No 17 
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=64.08  E-value=3.4  Score=31.53  Aligned_cols=12  Identities=42%  Similarity=0.501  Sum_probs=10.4

Q ss_pred             cEEEEecchhhH
Q 036986          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 rivFVGDSl~Rn  129 (178)
                      ||+|+|||++-.
T Consensus         2 ~i~~~GDSit~G   13 (177)
T cd01822           2 TILALGDSLTAG   13 (177)
T ss_pred             eEEEEccccccC
Confidence            799999999755


No 18 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=63.44  E-value=3.7  Score=31.77  Aligned_cols=15  Identities=40%  Similarity=0.718  Sum_probs=11.8

Q ss_pred             cEEEEecchhhHHHH
Q 036986          118 NIGFVGDSLNENFIV  132 (178)
Q Consensus       118 rivFVGDSl~Rn~~~  132 (178)
                      +|+|+|||++-....
T Consensus         1 ~i~~iGDSit~G~~~   15 (169)
T cd01831           1 KIEFIGDSITCGYGV   15 (169)
T ss_pred             CEEEEeccccccCcc
Confidence            589999999986433


No 19 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=63.22  E-value=4  Score=32.67  Aligned_cols=15  Identities=27%  Similarity=0.574  Sum_probs=12.9

Q ss_pred             CCcEEEEecchhhHH
Q 036986          116 NKNIGFVGDSLNENF  130 (178)
Q Consensus       116 gKrivFVGDSl~Rn~  130 (178)
                      +.+|+|+|||++.+.
T Consensus        10 ~~~iv~~GDSit~G~   24 (191)
T PRK10528         10 ADTLLILGDSLSAGY   24 (191)
T ss_pred             CCEEEEEeCchhhcC
Confidence            679999999999663


No 20 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=62.87  E-value=2.9  Score=31.63  Aligned_cols=12  Identities=33%  Similarity=0.327  Sum_probs=10.0

Q ss_pred             cEEEEecchhhH
Q 036986          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 rivFVGDSl~Rn  129 (178)
                      +|+|||||++-.
T Consensus         2 ~~~~~Gds~~~g   13 (157)
T cd01833           2 RIMPLGDSITWG   13 (157)
T ss_pred             ceeecCCceeec
Confidence            689999998765


No 21 
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=61.88  E-value=7.7  Score=36.73  Aligned_cols=33  Identities=21%  Similarity=0.291  Sum_probs=26.5

Q ss_pred             HHHHhcCCcEEEEecchhhHH-HHHHHHhhhhcc
Q 036986          110 FLSLMRNKNIGFVGDSLNENF-IVSFLCVLRAAD  142 (178)
Q Consensus       110 fl~~lrgKrivFVGDSl~Rn~-~~SL~clL~~~~  142 (178)
                      +.+.++||||+.|=||+-|.- ...++.||+.+-
T Consensus       342 vr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReAG  375 (470)
T COG0034         342 VREVVKGKRVVLVDDSIVRGTTSRRIVQMLREAG  375 (470)
T ss_pred             hHHHhCCCeEEEEccccccCccHHHHHHHHHHhC
Confidence            556788999999999999975 666778888543


No 22 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=58.74  E-value=3.6  Score=29.84  Aligned_cols=14  Identities=29%  Similarity=0.494  Sum_probs=11.5

Q ss_pred             EEEEecchhhHHHH
Q 036986          119 IGFVGDSLNENFIV  132 (178)
Q Consensus       119 ivFVGDSl~Rn~~~  132 (178)
                      |+|+|||++.+...
T Consensus         1 i~~~GDS~~~g~~~   14 (187)
T cd00229           1 ILVIGDSITAGYGA   14 (187)
T ss_pred             CeeeccccccccCC
Confidence            68999999988743


No 23 
>PF09949 DUF2183:  Uncharacterized conserved protein (DUF2183);  InterPro: IPR019236  This domain, found in various bacterial and fungal proteins, has no known function. 
Probab=57.68  E-value=9.2  Score=28.64  Aligned_cols=23  Identities=17%  Similarity=0.264  Sum_probs=18.4

Q ss_pred             hHHHHHHhcCCcEEEEecchhhH
Q 036986          107 PVKFLSLMRNKNIGFVGDSLNEN  129 (178)
Q Consensus       107 ~~~fl~~lrgKrivFVGDSl~Rn  129 (178)
                      -+++++..-+++.++||||--.-
T Consensus        55 i~~i~~~fP~~kfiLIGDsgq~D   77 (100)
T PF09949_consen   55 IERILRDFPERKFILIGDSGQHD   77 (100)
T ss_pred             HHHHHHHCCCCcEEEEeeCCCcC
Confidence            35677778899999999996553


No 24 
>PF12026 DUF3513:  Domain of unknown function (DUF3513);  InterPro: IPR021901  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with PF00018 from PFAM, PF08824 from PFAM. This domain has a conserved QPP sequence motif. ; PDB: 3T6G_D 1X27_N.
Probab=57.60  E-value=0.61  Score=39.63  Aligned_cols=17  Identities=24%  Similarity=0.536  Sum_probs=13.9

Q ss_pred             hcCCcEEEEecchhhHH
Q 036986          114 MRNKNIGFVGDSLNENF  130 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~  130 (178)
                      |-|-++|||||++.|+.
T Consensus       132 l~ahkLVfiGDTl~r~~  148 (210)
T PF12026_consen  132 LSAHKLVFIGDTLCREA  148 (210)
T ss_dssp             HHHHHHHHHHHHHHHC-
T ss_pred             EEeeeeeeeccHHHHHh
Confidence            45888999999999875


No 25 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=56.04  E-value=6  Score=30.87  Aligned_cols=14  Identities=21%  Similarity=0.261  Sum_probs=11.9

Q ss_pred             CcEEEEecchhhHH
Q 036986          117 KNIGFVGDSLNENF  130 (178)
Q Consensus       117 KrivFVGDSl~Rn~  130 (178)
                      .|++|+|||++-..
T Consensus         3 ~~i~~~GDSit~G~   16 (191)
T cd01836           3 LRLLVLGDSTAAGV   16 (191)
T ss_pred             eEEEEEeccccccc
Confidence            47999999999774


No 26 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=55.58  E-value=6  Score=30.62  Aligned_cols=12  Identities=25%  Similarity=0.385  Sum_probs=10.4

Q ss_pred             CcEEEEecchhh
Q 036986          117 KNIGFVGDSLNE  128 (178)
Q Consensus       117 KrivFVGDSl~R  128 (178)
                      .||+|+|||++.
T Consensus         1 ~~i~~~GDSi~~   12 (183)
T cd04501           1 MRVVCLGDSITY   12 (183)
T ss_pred             CeEEEEcccccc
Confidence            379999999995


No 27 
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=55.09  E-value=6.4  Score=31.37  Aligned_cols=12  Identities=33%  Similarity=0.183  Sum_probs=10.7

Q ss_pred             cEEEEecchhhH
Q 036986          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 rivFVGDSl~Rn  129 (178)
                      +|+|+|||++..
T Consensus         1 ~I~~~GDSiT~G   12 (208)
T cd01839           1 TILCFGDSNTWG   12 (208)
T ss_pred             CEEEEecCcccC
Confidence            589999999986


No 28 
>PRK14805 ornithine carbamoyltransferase; Provisional
Probab=54.74  E-value=9  Score=33.86  Aligned_cols=27  Identities=19%  Similarity=0.298  Sum_probs=21.8

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|++|+||||.  +|...|++.++..
T Consensus       143 g~l~g~kva~vGD~--~~v~~S~~~~~~~  169 (302)
T PRK14805        143 GDVSKVKLAYVGDG--NNVTHSLMYGAAI  169 (302)
T ss_pred             CCcCCcEEEEEcCC--CccHHHHHHHHHH
Confidence            34789999999994  5788999888764


No 29 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=54.60  E-value=6.5  Score=31.42  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=10.3

Q ss_pred             cEEEEecchhhH
Q 036986          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 rivFVGDSl~Rn  129 (178)
                      +|+|+|||++..
T Consensus         1 ~iv~~GDSiT~G   12 (204)
T cd01830           1 SVVALGDSITDG   12 (204)
T ss_pred             CEEEEecccccC
Confidence            489999999964


No 30 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.39  E-value=6  Score=30.29  Aligned_cols=13  Identities=46%  Similarity=0.577  Sum_probs=10.8

Q ss_pred             EEEEecchhhHHH
Q 036986          119 IGFVGDSLNENFI  131 (178)
Q Consensus       119 ivFVGDSl~Rn~~  131 (178)
                      |+|+|||+++..-
T Consensus         2 v~~~GdSi~~~~~   14 (169)
T cd01828           2 LVFLGDSLTEGGP   14 (169)
T ss_pred             EEEecchhhccCc
Confidence            7899999997653


No 31 
>PRK04284 ornithine carbamoyltransferase; Provisional
Probab=50.21  E-value=13  Score=33.34  Aligned_cols=27  Identities=19%  Similarity=0.265  Sum_probs=21.8

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|+||||..+ |...|++-++..
T Consensus       152 ~l~g~kia~vGD~~~-~v~~Sl~~~~~~  178 (332)
T PRK04284        152 PYKDIKFTYVGDGRN-NVANALMQGAAI  178 (332)
T ss_pred             CcCCcEEEEecCCCc-chHHHHHHHHHH
Confidence            467999999999766 588888887764


No 32 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=50.04  E-value=8.5  Score=30.40  Aligned_cols=14  Identities=29%  Similarity=0.356  Sum_probs=11.9

Q ss_pred             cEEEEecchhhHHH
Q 036986          118 NIGFVGDSLNENFI  131 (178)
Q Consensus       118 rivFVGDSl~Rn~~  131 (178)
                      +|+|+|||++....
T Consensus         2 ~i~~~GDS~t~G~~   15 (198)
T cd01821           2 TIFLAGDSTVADYD   15 (198)
T ss_pred             EEEEEecCCcccCC
Confidence            68999999998663


No 33 
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=47.77  E-value=9.1  Score=29.41  Aligned_cols=13  Identities=31%  Similarity=0.184  Sum_probs=10.8

Q ss_pred             EEEEecchhhHHH
Q 036986          119 IGFVGDSLNENFI  131 (178)
Q Consensus       119 ivFVGDSl~Rn~~  131 (178)
                      |+|||||+.+.--
T Consensus         2 i~~~g~s~~~~w~   14 (171)
T cd04502           2 ILFYGSSSIRLWD   14 (171)
T ss_pred             EEEEcCchhcchh
Confidence            7999999987653


No 34 
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=44.78  E-value=18  Score=32.08  Aligned_cols=29  Identities=17%  Similarity=0.205  Sum_probs=22.7

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|++|+||||-..-|...|++-++..
T Consensus       152 G~l~g~kv~~vGD~~~~~v~~Sl~~~~~~  180 (305)
T PRK00856        152 GRLEGLKVAIVGDIKHSRVARSNIQALTR  180 (305)
T ss_pred             CCCCCCEEEEECCCCCCcHHHHHHHHHHH
Confidence            34789999999997655778888877654


No 35 
>PLN02527 aspartate carbamoyltransferase
Probab=43.92  E-value=19  Score=31.84  Aligned_cols=27  Identities=26%  Similarity=0.401  Sum_probs=21.2

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhh
Q 036986          113 LMRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       113 ~lrgKrivFVGDSl~Rn~~~SL~clL~  139 (178)
                      .++|++|+||||-.+-+...|++-.+.
T Consensus       148 ~l~g~kva~vGD~~~~rv~~Sl~~~~~  174 (306)
T PLN02527        148 RLDGIKVGLVGDLANGRTVRSLAYLLA  174 (306)
T ss_pred             CcCCCEEEEECCCCCChhHHHHHHHHH
Confidence            478999999999865467888777664


No 36 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=43.19  E-value=12  Score=29.51  Aligned_cols=12  Identities=50%  Similarity=0.639  Sum_probs=10.7

Q ss_pred             cEEEEecchhhH
Q 036986          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 rivFVGDSl~Rn  129 (178)
                      +|+|+|||++..
T Consensus         1 ~i~~~GDSit~G   12 (204)
T cd04506           1 KIVALGDSLTEG   12 (204)
T ss_pred             CEeEEeccccCc
Confidence            589999999996


No 37 
>PRK02102 ornithine carbamoyltransferase; Validated
Probab=43.08  E-value=20  Score=32.20  Aligned_cols=27  Identities=22%  Similarity=0.348  Sum_probs=21.8

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|++|||..+ |...|++.++..
T Consensus       152 ~l~g~~va~vGd~~~-~v~~Sl~~~~~~  178 (331)
T PRK02102        152 PLKGLKLAYVGDGRN-NMANSLMVGGAK  178 (331)
T ss_pred             CCCCCEEEEECCCcc-cHHHHHHHHHHH
Confidence            467999999999865 488888887764


No 38 
>PF00702 Hydrolase:  haloacid dehalogenase-like hydrolase;  InterPro: IPR005834  This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase). This group includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment, between residues 16 and 96 of HAD1_PSESP. The rest of the fold is composed of the core alpha/beta domain.; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1TE2_A 3NAL_A 3NAM_A 3NAN_A 3A1D_B 3J09_A 3J08_A 2B8E_C 3A1E_A 2VOY_J ....
Probab=42.92  E-value=21  Score=27.81  Aligned_cols=20  Identities=20%  Similarity=0.579  Sum_probs=15.4

Q ss_pred             HHHHHHhc--CCcEEEEecchh
Q 036986          108 VKFLSLMR--NKNIGFVGDSLN  127 (178)
Q Consensus       108 ~~fl~~lr--gKrivFVGDSl~  127 (178)
                      ..+.+.|+  +.++++|||+++
T Consensus       185 ~~~i~~l~~~~~~v~~vGDg~n  206 (215)
T PF00702_consen  185 LRIIKELQVKPGEVAMVGDGVN  206 (215)
T ss_dssp             HHHHHHHTCTGGGEEEEESSGG
T ss_pred             HHHHHHHhcCCCEEEEEccCHH
Confidence            45667765  569999999984


No 39 
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. Note that SP|P53981 from S. cerevisiae, a member of this family, is annotated as a "probable membrane protein" due to a predicted transmembrane helix. The region in question contains the second of the three conserved HAD superfamily catalytic motifs and thus, considering the fold of the HAD catalytic domain, is unlikely to be a transmembrane region in fact.
Probab=40.63  E-value=31  Score=26.45  Aligned_cols=13  Identities=23%  Similarity=0.659  Sum_probs=10.7

Q ss_pred             CCcEEEEecchhh
Q 036986          116 NKNIGFVGDSLNE  128 (178)
Q Consensus       116 gKrivFVGDSl~R  128 (178)
                      .++++|||||.+=
T Consensus       162 ~~~~i~iGD~~~D  174 (188)
T TIGR01489       162 YQHIIYIGDGVTD  174 (188)
T ss_pred             CceEEEECCCcch
Confidence            5689999999763


No 40 
>PRK01713 ornithine carbamoyltransferase; Provisional
Probab=40.31  E-value=23  Score=31.74  Aligned_cols=26  Identities=23%  Similarity=0.304  Sum_probs=20.8

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|++|+||||-.+ |...|++.++..
T Consensus       154 l~gl~ia~vGD~~~-~v~~Sl~~~~~~  179 (334)
T PRK01713        154 LSEISYVYIGDARN-NMGNSLLLIGAK  179 (334)
T ss_pred             cCCcEEEEECCCcc-CHHHHHHHHHHH
Confidence            67899999999654 488888877764


No 41 
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=40.26  E-value=21  Score=27.22  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=14.2

Q ss_pred             EEEEecchhhHHHHHHHHhh
Q 036986          119 IGFVGDSLNENFIVSFLCVL  138 (178)
Q Consensus       119 ivFVGDSl~Rn~~~SL~clL  138 (178)
                      |.|+|||++-..-..+...+
T Consensus         2 v~~~GDSv~~~~~~~~~~~~   21 (150)
T cd01840           2 ITAIGDSVMLDSSPALQEIF   21 (150)
T ss_pred             eeEEeehHHHchHHHHHHHC
Confidence            78999999987655544433


No 42 
>PLN02342 ornithine carbamoyltransferase
Probab=40.12  E-value=23  Score=32.07  Aligned_cols=26  Identities=23%  Similarity=0.482  Sum_probs=21.5

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.|++|+||||-  .|...|++.++..
T Consensus       191 ~l~glkva~vGD~--~nva~Sli~~~~~  216 (348)
T PLN02342        191 RLEGTKVVYVGDG--NNIVHSWLLLAAV  216 (348)
T ss_pred             CcCCCEEEEECCC--chhHHHHHHHHHH
Confidence            4779999999994  3699999988764


No 43 
>PF04954 SIP:  Siderophore-interacting protein;  InterPro: IPR007037 This entry includes the vibriobactin utilization protein viuB, which is involved in the removal of iron from iron-vibriobactin complexes, as well as several hypothetical proteins.; PDB: 2GPJ_A.
Probab=39.97  E-value=60  Score=24.26  Aligned_cols=24  Identities=29%  Similarity=0.231  Sum_probs=20.1

Q ss_pred             CcEEEEecchhhHHHHHHHHhhhh
Q 036986          117 KNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       117 KrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ++++||||.++---..+++.-|..
T Consensus         2 ~~~ll~gDeTalPAi~~iLe~lp~   25 (119)
T PF04954_consen    2 DRYLLVGDETALPAIARILEALPA   25 (119)
T ss_dssp             SEEEEEEEGGGHHHHHHHHHHS-T
T ss_pred             ceEEEEeccccHHHHHHHHHhCCC
Confidence            578999999999999998887743


No 44 
>PF01861 DUF43:  Protein of unknown function DUF43;  InterPro: IPR002723 This family of prokaryotic proteins have not been characterised. All the members are 350-400 amino acids long.; PDB: 2QM3_A.
Probab=38.21  E-value=15  Score=31.98  Aligned_cols=12  Identities=42%  Similarity=0.758  Sum_probs=8.8

Q ss_pred             hcCCcEEEEecc
Q 036986          114 MRNKNIGFVGDS  125 (178)
Q Consensus       114 lrgKrivFVGDS  125 (178)
                      |.||+|+||||=
T Consensus        43 L~gk~il~lGDD   54 (243)
T PF01861_consen   43 LEGKRILFLGDD   54 (243)
T ss_dssp             STT-EEEEES-T
T ss_pred             ccCCEEEEEcCC
Confidence            689999999993


No 45 
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism]
Probab=38.06  E-value=24  Score=31.77  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=18.5

Q ss_pred             hcCCcEEEEecchhhHHHHHHHH
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLC  136 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~c  136 (178)
                      ++|++++||||-  -|+-.||+-
T Consensus       151 l~g~k~a~vGDg--NNv~nSl~~  171 (310)
T COG0078         151 LKGLKLAYVGDG--NNVANSLLL  171 (310)
T ss_pred             ccCcEEEEEcCc--chHHHHHHH
Confidence            789999999998  888888764


No 46 
>PRK08192 aspartate carbamoyltransferase; Provisional
Probab=37.60  E-value=25  Score=31.59  Aligned_cols=26  Identities=23%  Similarity=0.230  Sum_probs=20.6

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~  139 (178)
                      +.|++|+||||-..-|...|++.+|.
T Consensus       157 l~g~kia~vGD~~~~rv~~Sl~~~l~  182 (338)
T PRK08192        157 IDGMHIAMVGDLKFGRTVHSLSRLLC  182 (338)
T ss_pred             cCCCEEEEECcCCCCchHHHHHHHHH
Confidence            67899999999765577888877654


No 47 
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=35.60  E-value=44  Score=31.48  Aligned_cols=29  Identities=34%  Similarity=0.597  Sum_probs=20.0

Q ss_pred             HHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          109 KFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       109 ~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      +..+.++|||++++||+.   +-.+|+..|..
T Consensus       307 d~~~~L~GKrvai~Gdp~---~~i~LarfL~e  335 (457)
T CHL00073        307 DYLDLVRGKSVFFMGDNL---LEISLARFLIR  335 (457)
T ss_pred             HHHHHHCCCEEEEECCCc---HHHHHHHHHHH
Confidence            455668999999999963   44455555543


No 48 
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase. Ornithine carbamoyltransferases are in the same superfamily and form an outgroup.
Probab=35.50  E-value=23  Score=31.24  Aligned_cols=29  Identities=21%  Similarity=0.198  Sum_probs=22.5

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|++|+||||-..-|...|++-++..
T Consensus       146 g~l~g~~va~vGD~~~~~v~~Sl~~~~a~  174 (301)
T TIGR00670       146 GRLDGLKIALVGDLKYGRTVHSLAEALTR  174 (301)
T ss_pred             CCCCCCEEEEEccCCCCcHHHHHHHHHHH
Confidence            34789999999997655777887776654


No 49 
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=34.98  E-value=37  Score=31.98  Aligned_cols=33  Identities=21%  Similarity=0.242  Sum_probs=25.9

Q ss_pred             HHHhcCCcEEEEecchhhHH-HHHHHHhhhhccc
Q 036986          111 LSLMRNKNIGFVGDSLNENF-IVSFLCVLRAADS  143 (178)
Q Consensus       111 l~~lrgKrivFVGDSl~Rn~-~~SL~clL~~~~~  143 (178)
                      .+-+.||||+.|-||+.|.- .--++.||+.+-+
T Consensus       351 ~~~~~GKrvvlVDDSIVRGtTs~~IVkmlreaGA  384 (474)
T KOG0572|consen  351 RQNFEGKRVVLVDDSIVRGTTSSPIVKMLREAGA  384 (474)
T ss_pred             hhhcCCceEEEEecceeccCchHHHHHHHHHcCC
Confidence            34577999999999999965 6678888886533


No 50 
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional
Probab=34.16  E-value=33  Score=30.86  Aligned_cols=26  Identities=23%  Similarity=0.273  Sum_probs=20.8

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ++|++|++|||..+ |...|++.++..
T Consensus       154 l~gl~va~vGD~~~-~v~~S~~~~~~~  179 (334)
T PRK12562        154 FNEMTLVYAGDARN-NMGNSMLEAAAL  179 (334)
T ss_pred             cCCcEEEEECCCCC-CHHHHHHHHHHH
Confidence            57899999999864 588888877654


No 51 
>PRK11891 aspartate carbamoyltransferase; Provisional
Probab=34.11  E-value=33  Score=32.07  Aligned_cols=26  Identities=23%  Similarity=0.321  Sum_probs=20.7

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~  139 (178)
                      ++|++|+||||-..-|...|++.++.
T Consensus       239 l~G~kIa~vGD~~~~rv~~Sl~~~la  264 (429)
T PRK11891        239 VDGAHIALVGDLKYGRTVHSLVKLLA  264 (429)
T ss_pred             cCCCEEEEECcCCCChHHHHHHHHHH
Confidence            56899999999865577888877754


No 52 
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism]
Probab=32.33  E-value=15  Score=33.16  Aligned_cols=45  Identities=18%  Similarity=0.136  Sum_probs=37.2

Q ss_pred             eCCCCCCCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986           96 VPETCDLPRINPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus        96 qP~~C~lp~fd~~~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      -|.++.|--|+-.+-...+.|++|++|||=.--.-.-|++.+|..
T Consensus       138 HPTQ~LLDl~TI~~~~G~~~gl~iaivGDlkhsRva~S~~~~L~~  182 (316)
T COG0540         138 HPTQALLDLYTIREEFGRLDGLKIAIVGDLKHSRVAHSNIQALKR  182 (316)
T ss_pred             CccHHHHHHHHHHHHhCCcCCcEEEEEccccchHHHHHHHHHHHH
Confidence            377777777777777777999999999999888888888888875


No 53 
>PF00657 Lipase_GDSL:  GDSL-like Lipase/Acylhydrolase;  InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=30.81  E-value=25  Score=27.34  Aligned_cols=11  Identities=45%  Similarity=0.667  Sum_probs=10.2

Q ss_pred             EEEEecchhhH
Q 036986          119 IGFVGDSLNEN  129 (178)
Q Consensus       119 ivFVGDSl~Rn  129 (178)
                      |+++|||++-.
T Consensus         1 i~~fGDS~td~   11 (234)
T PF00657_consen    1 IVVFGDSLTDG   11 (234)
T ss_dssp             EEEEESHHHHT
T ss_pred             CEEEeehhccc
Confidence            68999999999


No 54 
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional
Probab=30.26  E-value=42  Score=30.19  Aligned_cols=26  Identities=23%  Similarity=0.327  Sum_probs=20.5

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|.+|+||||-.+ |...|++-++..
T Consensus       154 l~g~~ia~vGD~~~-~v~~Sl~~~~~~  179 (336)
T PRK03515        154 FNEMTLAYAGDARN-NMGNSLLEAAAL  179 (336)
T ss_pred             cCCCEEEEeCCCcC-cHHHHHHHHHHH
Confidence            57899999999534 588888887764


No 55 
>PRK14804 ornithine carbamoyltransferase; Provisional
Probab=29.98  E-value=41  Score=29.79  Aligned_cols=26  Identities=19%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|++|||  .-|...|++-++..
T Consensus       150 ~l~g~~va~vGd--~~rv~~Sl~~~~~~  175 (311)
T PRK14804        150 PLNQKQLTYIGV--HNNVVNSLIGITAA  175 (311)
T ss_pred             CCCCCEEEEECC--CCcHHHHHHHHHHH
Confidence            478999999999  35777888777664


No 56 
>PRK00779 ornithine carbamoyltransferase; Provisional
Probab=29.64  E-value=30  Score=30.57  Aligned_cols=42  Identities=19%  Similarity=0.183  Sum_probs=27.0

Q ss_pred             CCCCCCCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986           97 PETCDLPRINPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus        97 P~~C~lp~fd~~~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      |.+..+--|+-.+-...++|++|++||| .+ +...|++.++..
T Consensus       133 PtQaL~Dl~Ti~e~~g~l~gl~i~~vGd-~~-~v~~Sl~~~l~~  174 (304)
T PRK00779        133 PCQILADLLTIYEHRGSLKGLKVAWVGD-GN-NVANSLLLAAAL  174 (304)
T ss_pred             hHHHHHHHHHHHHHhCCcCCcEEEEEeC-CC-ccHHHHHHHHHH
Confidence            4433333333333344578999999999 34 588888887764


No 57 
>PF13242 Hydrolase_like:  HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B ....
Probab=29.36  E-value=56  Score=22.04  Aligned_cols=20  Identities=25%  Similarity=0.277  Sum_probs=14.9

Q ss_pred             cCCcEEEEecchhhHHHHHH
Q 036986          115 RNKNIGFVGDSLNENFIVSF  134 (178)
Q Consensus       115 rgKrivFVGDSl~Rn~~~SL  134 (178)
                      .-.++++||||+..-+--+-
T Consensus        20 ~~~~~~~VGD~~~~Di~~a~   39 (75)
T PF13242_consen   20 DPSRCVMVGDSLETDIEAAK   39 (75)
T ss_dssp             GGGGEEEEESSTTTHHHHHH
T ss_pred             CHHHEEEEcCCcHhHHHHHH
Confidence            35789999999777665543


No 58 
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase. Most OTCases are homotrimers, but the homotrimers are organized into dodecamers built from four trimers in at least two species; the catabolic OTCase of Pseudomonas aeruginosa is allosterically regulated, while OTCase of the extreme thermophile Pyrococcus furiosus shows both allostery and thermophily.
Probab=28.61  E-value=46  Score=29.33  Aligned_cols=25  Identities=24%  Similarity=0.396  Sum_probs=20.8

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|.+|++|||. + +...|++.++..
T Consensus       146 l~g~~v~~vGd~-~-~v~~Sl~~~l~~  170 (304)
T TIGR00658       146 LKGVKVVYVGDG-N-NVCNSLMLAGAK  170 (304)
T ss_pred             CCCcEEEEEeCC-C-chHHHHHHHHHH
Confidence            679999999996 3 588999888764


No 59 
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=28.60  E-value=52  Score=25.64  Aligned_cols=16  Identities=44%  Similarity=0.698  Sum_probs=11.8

Q ss_pred             HHHHhcC-CcEEEEecc
Q 036986          110 FLSLMRN-KNIGFVGDS  125 (178)
Q Consensus       110 fl~~lrg-KrivFVGDS  125 (178)
                      +.-+.++ |++++|||.
T Consensus       210 l~~l~~~~~~~vlvGD~  226 (236)
T PF13086_consen  210 LIPLSRAPKRIVLVGDP  226 (236)
T ss_dssp             HHHHTTTBSEEEEEE-T
T ss_pred             HHHHHHhCCEEEEECCh
Confidence            3456778 999999995


No 60 
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=27.90  E-value=30  Score=28.38  Aligned_cols=13  Identities=23%  Similarity=0.146  Sum_probs=10.3

Q ss_pred             cEEEEecchhhHH
Q 036986          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 rivFVGDSl~Rn~  130 (178)
                      +++++|||++-+.
T Consensus         2 ~~v~iGDS~~~G~   14 (259)
T cd01823           2 RYVALGDSYAAGP   14 (259)
T ss_pred             CEEEecchhhcCC
Confidence            7899999987543


No 61 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=26.63  E-value=57  Score=26.43  Aligned_cols=34  Identities=18%  Similarity=0.162  Sum_probs=24.1

Q ss_pred             CChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          105 INPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       105 fd~~~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      -.-+++.+.++||.++|+|-|=.--  -||+..|..
T Consensus        24 ~g~~~l~~~l~~k~~vl~G~SGvGK--SSLiN~L~~   57 (161)
T PF03193_consen   24 EGIEELKELLKGKTSVLLGQSGVGK--SSLINALLP   57 (161)
T ss_dssp             TTHHHHHHHHTTSEEEEECSTTSSH--HHHHHHHHT
T ss_pred             cCHHHHHHHhcCCEEEEECCCCCCH--HHHHHHHHh
Confidence            3457889999999999999874443  245555544


No 62 
>PF12710 HAD:  haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B.
Probab=25.61  E-value=51  Score=25.26  Aligned_cols=13  Identities=31%  Similarity=0.491  Sum_probs=11.4

Q ss_pred             cCCcEEEEecchh
Q 036986          115 RNKNIGFVGDSLN  127 (178)
Q Consensus       115 rgKrivFVGDSl~  127 (178)
                      ..+++++||||.+
T Consensus       174 ~~~~~~~iGDs~~  186 (192)
T PF12710_consen  174 DPDRVIAIGDSIN  186 (192)
T ss_dssp             TCCEEEEEESSGG
T ss_pred             CCCeEEEEECCHH
Confidence            4789999999986


No 63 
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase. Members of this family are the methionine salvage enzyme MnxX, a member of the HAD-superfamily hydrolases, subfamily IB (see TIGR01488). Members are found in Bacillus subtilis and related species, paired with MtnW (TIGR03332). In most species that recycle methionine from methylthioadenosine, the single protein MtnC replaces the MtnW/MtnX pair. In B. subtilis, mtnX was first known as ykrX.
Probab=25.43  E-value=54  Score=26.49  Aligned_cols=14  Identities=29%  Similarity=0.406  Sum_probs=11.6

Q ss_pred             cCCcEEEEecchhh
Q 036986          115 RNKNIGFVGDSLNE  128 (178)
Q Consensus       115 rgKrivFVGDSl~R  128 (178)
                      +..++++||||.+=
T Consensus       155 ~~~~~i~iGDg~~D  168 (214)
T TIGR03333       155 PNDYHIVIGDSVTD  168 (214)
T ss_pred             cCCcEEEEeCCHHH
Confidence            56789999999775


No 64 
>PRK10113 cell division modulator; Provisional
Probab=25.36  E-value=36  Score=24.51  Aligned_cols=17  Identities=35%  Similarity=0.751  Sum_probs=12.9

Q ss_pred             HhcCCcEEEE--ecchhhH
Q 036986          113 LMRNKNIGFV--GDSLNEN  129 (178)
Q Consensus       113 ~lrgKrivFV--GDSl~Rn  129 (178)
                      .||||-++||  |||.-|.
T Consensus        38 ~LrGKYVAFvl~ge~FrRS   56 (80)
T PRK10113         38 MLRGKYVAFVLMGESFLRS   56 (80)
T ss_pred             eeccceEEEEEechhhccC
Confidence            5899999986  7766553


No 65 
>PRK02255 putrescine carbamoyltransferase; Provisional
Probab=25.09  E-value=62  Score=29.14  Aligned_cols=24  Identities=25%  Similarity=0.513  Sum_probs=20.1

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~  139 (178)
                      +.|++|++|||-  .|...|++.++.
T Consensus       152 l~glkv~~vGD~--~~v~~Sl~~~~~  175 (338)
T PRK02255        152 LEDCKVVFVGDA--TQVCVSLMFIAT  175 (338)
T ss_pred             CCCCEEEEECCC--chHHHHHHHHHH
Confidence            678999999995  368899888776


No 66 
>PF13289 SIR2_2:  SIR2-like domain
Probab=25.01  E-value=1.5e+02  Score=21.72  Aligned_cols=32  Identities=31%  Similarity=0.355  Sum_probs=23.8

Q ss_pred             HHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          109 KFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       109 ~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.+.++.+.++|||=|+.-..+..++.-+..
T Consensus        79 ~l~~~l~~~~~lfiGys~~D~~i~~~l~~~~~  110 (143)
T PF13289_consen   79 FLRSLLRSKTLLFIGYSFNDPDIRQLLRSALE  110 (143)
T ss_pred             HHHHHHcCCCEEEEEECCCCHHHHHHHHHHHH
Confidence            34577889999999999877666666655444


No 67 
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=24.12  E-value=75  Score=23.30  Aligned_cols=15  Identities=40%  Similarity=0.534  Sum_probs=12.0

Q ss_pred             cCCcEEEEecchhhHH
Q 036986          115 RNKNIGFVGDSLNENF  130 (178)
Q Consensus       115 rgKrivFVGDSl~Rn~  130 (178)
                      ..++++||||+. .+.
T Consensus       149 ~p~~~~~vgD~~-~d~  163 (176)
T PF13419_consen  149 PPEEILFVGDSP-SDV  163 (176)
T ss_dssp             SGGGEEEEESSH-HHH
T ss_pred             CcceEEEEeCCH-HHH
Confidence            467899999998 554


No 68 
>PLN02954 phosphoserine phosphatase
Probab=24.04  E-value=66  Score=25.71  Aligned_cols=13  Identities=23%  Similarity=0.511  Sum_probs=10.6

Q ss_pred             CCcEEEEecchhh
Q 036986          116 NKNIGFVGDSLNE  128 (178)
Q Consensus       116 gKrivFVGDSl~R  128 (178)
                      -+++++||||.+=
T Consensus       169 ~~~~i~iGDs~~D  181 (224)
T PLN02954        169 YKTMVMIGDGATD  181 (224)
T ss_pred             CCceEEEeCCHHH
Confidence            3689999999774


No 69 
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=23.47  E-value=48  Score=29.47  Aligned_cols=29  Identities=14%  Similarity=0.117  Sum_probs=21.4

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 036986          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgKrivFVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|.+|+||||-..-|.-.|++-++..
T Consensus       153 g~l~g~~va~vGD~~~~rv~~Sl~~~~a~  181 (310)
T PRK13814        153 PHWNKLCVTIIGDIRHSRVANSLMDGLVT  181 (310)
T ss_pred             CCcCCcEEEEECCCCCCcHHHHHHHHHHH
Confidence            34679999999997645677777776653


No 70 
>PF14647 FAM91_N:  FAM91 N-terminus
Probab=23.18  E-value=91  Score=28.17  Aligned_cols=30  Identities=20%  Similarity=0.401  Sum_probs=25.1

Q ss_pred             CCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhhc
Q 036986          102 LPRINPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRAA  141 (178)
Q Consensus       102 lp~fd~~~fl~~lrgKrivFVGDSl~Rn~~~SL~clL~~~  141 (178)
                      ||.|+++|.|+++.          ++||||-.++.-.++.
T Consensus       109 LPNFTAaD~LRllG----------IGRNqYIdlmn~~RS~  138 (308)
T PF14647_consen  109 LPNFTAADCLRLLG----------IGRNQYIDLMNKCRSK  138 (308)
T ss_pred             CCCCcHHHHHHHhc----------chHHHHHHHHHHhchh
Confidence            89999999998774          6799999988766654


No 71 
>PF09084 NMT1:  NMT1/THI5 like;  InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine [, , ]. They are regulated by thiamine []. ; PDB: 2X26_A 3E4R_A 3KSJ_A 3KSX_A 3UIF_A 4DDD_A 1US4_A 1US5_A 3IX1_B 2X7P_A ....
Probab=21.67  E-value=69  Score=25.17  Aligned_cols=25  Identities=28%  Similarity=0.416  Sum_probs=19.7

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHH
Q 036986          112 SLMRNKNIGFVGDSLNENFIVSFLC  136 (178)
Q Consensus       112 ~~lrgKrivFVGDSl~Rn~~~SL~c  136 (178)
                      +-|+||+|++.+.|.+.-.+..++.
T Consensus        89 ~DLkGK~i~v~~~s~~~~~~~~~l~  113 (216)
T PF09084_consen   89 ADLKGKKIGVSRGSSSEYFLRALLK  113 (216)
T ss_dssp             GGGTTSEEEESTTSHHHHHHHHHHH
T ss_pred             HHhCCCEEEEecCcchhHHHHHHHH
Confidence            4479999999998887777776554


No 72 
>PHA02597 30.2 hypothetical protein; Provisional
Probab=20.97  E-value=69  Score=25.15  Aligned_cols=23  Identities=17%  Similarity=0.300  Sum_probs=15.3

Q ss_pred             ChHHHHHHhcC---CcEEEEecchhh
Q 036986          106 NPVKFLSLMRN---KNIGFVGDSLNE  128 (178)
Q Consensus       106 d~~~fl~~lrg---KrivFVGDSl~R  128 (178)
                      +++-++.+++.   ..++|||||..=
T Consensus       132 kp~~~~~a~~~~~~~~~v~vgDs~~d  157 (197)
T PHA02597        132 KEKLFIKAKEKYGDRVVCFVDDLAHN  157 (197)
T ss_pred             cHHHHHHHHHHhCCCcEEEeCCCHHH
Confidence            35656655553   348899999764


No 73 
>COG0546 Gph Predicted phosphatases [General function prediction only]
Probab=20.26  E-value=82  Score=25.67  Aligned_cols=17  Identities=35%  Similarity=0.434  Sum_probs=12.0

Q ss_pred             HHhcCC--cEEEEecchhh
Q 036986          112 SLMRNK--NIGFVGDSLNE  128 (178)
Q Consensus       112 ~~lrgK--rivFVGDSl~R  128 (178)
                      +.+...  ++++||||..-
T Consensus       156 ~~~~~~~~~~l~VGDs~~D  174 (220)
T COG0546         156 EKLGLDPEEALMVGDSLND  174 (220)
T ss_pred             HHhCCChhheEEECCCHHH
Confidence            444444  79999999654


No 74 
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=20.03  E-value=81  Score=30.34  Aligned_cols=26  Identities=27%  Similarity=0.240  Sum_probs=18.6

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 036986          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgKrivFVGDSl~Rn~~~SL~clL~  139 (178)
                      ++|++|++|||-..-|...|++.++.
T Consensus       172 l~glkVa~vGD~~~~rva~Sl~~~l~  197 (525)
T PRK13376        172 NSFIHIALVGDLLHGRTVHSKVNGLK  197 (525)
T ss_pred             cCCCEEEEECCCCCCcHHHHHHHHHH
Confidence            67899999999754455556666554


No 75 
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification]
Probab=20.02  E-value=94  Score=22.56  Aligned_cols=21  Identities=24%  Similarity=0.324  Sum_probs=17.7

Q ss_pred             CCCCCCChHHHHHHhcCCcEE
Q 036986          100 CDLPRINPVKFLSLMRNKNIG  120 (178)
Q Consensus       100 C~lp~fd~~~fl~~lrgKriv  120 (178)
                      |+...-+|..||+.|.||.++
T Consensus         2 ~a~~PvNPKpFL~~l~gk~V~   22 (79)
T KOG3482|consen    2 SAKQPVNPKPFLNGLTGKPVL   22 (79)
T ss_pred             CCcccCCchHHHhhccCCeEE
Confidence            555566999999999999987


Done!