Query         036994
Match_columns 129
No_of_seqs    105 out of 195
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:30:50 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/036994.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/036994hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2369 Lecithin:cholesterol a  99.6 1.1E-15 2.3E-20  134.1   6.6   79   41-129    30-113 (473)
  2 PLN02733 phosphatidylcholine-s  99.6 1.8E-15 3.9E-20  131.3   4.3   68   39-128    17-85  (440)
  3 PF02450 LCAT:  Lecithin:choles  99.2 7.5E-12 1.6E-16  106.1   4.0   47   83-129     1-47  (389)
  4 PLN02517 phosphatidylcholine-s  99.1 6.9E-11 1.5E-15  107.0   3.0   72   39-129    72-145 (642)
  5 PF07819 PGAP1:  PGAP1-like pro  79.9     1.2 2.5E-05   35.5   1.8   16   40-55      3-18  (225)
  6 TIGR02972 TMAO_torE trimethyla  73.2     2.2 4.8E-05   27.2   1.4   20   11-30      2-21  (47)
  7 PF06796 NapE:  Periplasmic nit  55.0      12 0.00027   24.6   2.3   20   11-30     10-29  (56)
  8 PF04083 Abhydro_lipase:  Parti  45.1      14  0.0003   24.2   1.4   17   38-54     40-56  (63)
  9 PRK11372 lysozyme inhibitor; P  38.7      23 0.00049   25.7   1.8   19   18-36      2-20  (109)
 10 PRK11126 2-succinyl-6-hydroxy-  38.4      22 0.00048   26.4   1.8   13   42-54      3-15  (242)
 11 PF06028 DUF915:  Alpha/beta hy  37.5      16 0.00036   29.9   1.0   16   39-54      9-24  (255)
 12 PF15232 DUF4585:  Domain of un  36.2      30 0.00066   24.1   2.0   14  104-117    29-42  (75)
 13 TIGR03695 menH_SHCHC 2-succiny  35.8      24 0.00052   25.1   1.5   14   42-55      2-15  (251)
 14 PRK10349 carboxylesterase BioH  33.9      25 0.00054   26.7   1.5   13   42-54     14-26  (256)
 15 PF06821 Ser_hydrolase:  Serine  33.9      25 0.00054   26.8   1.4   11   44-54      1-11  (171)
 16 TIGR01738 bioH putative pimelo  33.5      32 0.00069   24.6   1.9   14   41-54      4-17  (245)
 17 PF01674 Lipase_2:  Lipase (cla  32.8      27 0.00058   28.1   1.5   12   42-53      2-13  (219)
 18 PF00975 Thioesterase:  Thioest  32.2      28 0.00061   25.9   1.5   14   42-55      1-14  (229)
 19 PRK10673 acyl-CoA esterase; Pr  31.3      38 0.00083   25.3   2.1   16   39-54     14-29  (255)
 20 TIGR02240 PHA_depoly_arom poly  31.1      35 0.00076   26.4   1.9   15   41-55     25-39  (276)
 21 PF12695 Abhydrolase_5:  Alpha/  31.0      32 0.00069   23.3   1.5   12   43-54      1-12  (145)
 22 KOG4409 Predicted hydrolase/ac  28.0      33 0.00072   30.2   1.4   17   39-55     88-104 (365)
 23 TIGR01250 pro_imino_pep_2 prol  27.6      47   0.001   24.4   2.0   16   40-55     24-39  (288)
 24 TIGR03611 RutD pyrimidine util  26.2      49  0.0011   24.0   1.9   15   40-54     12-26  (257)
 25 cd04709 BAH_MTA BAH, or Bromo   26.1      52  0.0011   25.5   2.1   22  104-126   124-145 (164)
 26 COG3545 Predicted esterase of   26.0      47   0.001   26.6   1.8   14   41-54      2-15  (181)
 27 PRK03592 haloalkane dehalogena  25.3      51  0.0011   25.7   1.9   15   40-54     26-40  (295)
 28 PF12697 Abhydrolase_6:  Alpha/  25.2      48   0.001   23.1   1.6   11   44-54      1-11  (228)
 29 PLN02606 palmitoyl-protein thi  25.2   1E+02  0.0023   26.4   3.9   13   39-51     24-36  (306)
 30 PF08414 NADPH_Ox:  Respiratory  25.0      31 0.00068   25.2   0.6   18    9-26      3-20  (100)
 31 TIGR02973 nitrate_rd_NapE peri  24.5      46   0.001   20.7   1.2   16   15-30      1-16  (42)
 32 TIGR03343 biphenyl_bphD 2-hydr  24.0      59  0.0013   24.7   2.0   15   40-54     29-43  (282)
 33 PF11153 DUF2931:  Protein of u  23.9      74  0.0016   24.9   2.6   18   19-36      1-18  (216)
 34 PF10049 DUF2283:  Protein of u  23.0      50  0.0011   20.4   1.2   11  105-115     1-11  (50)
 35 TIGR03056 bchO_mg_che_rel puta  22.2      65  0.0014   24.1   1.9   15   41-55     28-42  (278)
 36 PLN02578 hydrolase              21.2      70  0.0015   26.3   2.0   13   42-54     87-99  (354)
 37 COG1075 LipA Predicted acetylt  20.7 1.1E+02  0.0024   25.6   3.2   15   40-54     58-72  (336)
 38 KOG2541 Palmitoyl protein thio  20.2 1.2E+02  0.0027   26.0   3.3   19   38-56     20-38  (296)
 39 KOG3724 Negative regulator of   20.2      56  0.0012   32.1   1.4   18   40-57     88-105 (973)

No 1  
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism]
Probab=99.60  E-value=1.1e-15  Score=134.10  Aligned_cols=79  Identities=46%  Similarity=0.869  Sum_probs=71.2

Q ss_pred             cccEEEecCCCCCccEEEeCCCCCCCc---cccccccccccCCCCcee--eecccCCCCCCCcCccccceeEEEcCCCCC
Q 036994           41 LHPLILVPGNGGNQLEARLTSDYKPSS---LLCNRWYPIVKDSEGWFR--LWFDPSVLLPPFTKCFADRMMLYYDPDLDD  115 (129)
Q Consensus        41 ~~PVILVPG~gGSqLeAkL~~~~~p~~---~~C~~~yc~~k~~~~wFr--LWln~~~liP~~~~C~~D~m~L~YD~~T~~  115 (129)
                      ..||+||||++|+||+++++.  +|.+   |.|.      +.++++||  ||.+...+++...+||.|++.|+||++|+.
T Consensus        30 ~~pv~lv~g~gg~~l~~v~~~--~p~vv~~W~~~------~~a~~~FrkrLW~~~~~l~~~~~~cw~~~~~lvld~~tGL  101 (473)
T KOG2369|consen   30 DRPVLLVPGDGGSQLHPVLDG--KPGVVRLWVCI------KCAEGYFRKRLWLDLNMLLPKTIDCWCDNEHLVLDPETGL  101 (473)
T ss_pred             CCceEEecCCccccccceecC--CCCEEEEEEee------cCchHHHhHHHhhhccccccccccccccceEEeecCccCC
Confidence            349999999999999999995  3654   5565      56789999  999999999999999999999999999998


Q ss_pred             ccCCCCcEEeCCCC
Q 036994          116 FHNSPGVETRVPHF  129 (129)
Q Consensus       116 ~~N~pGV~Irvp~F  129 (129)
                      +  +|||.+|||||
T Consensus       102 d--~pg~~lRvpgf  113 (473)
T KOG2369|consen  102 D--PPGVKLRVPGF  113 (473)
T ss_pred             C--CCcceeecCCc
Confidence            7  99999999998


No 2  
>PLN02733 phosphatidylcholine-sterol O-acyltransferase
Probab=99.56  E-value=1.8e-15  Score=131.29  Aligned_cols=68  Identities=29%  Similarity=0.430  Sum_probs=55.1

Q ss_pred             CCcccEEEecCCCCCccEEEeCCCCCCCccccccccccccCCCCceeeecccCCCCCCCcCccccceeEEEcCCCCCccC
Q 036994           39 RGLHPLILVPGNGGNQLEARLTSDYKPSSLLCNRWYPIVKDSEGWFRLWFDPSVLLPPFTKCFADRMMLYYDPDLDDFHN  118 (129)
Q Consensus        39 ~~~~PVILVPG~gGSqLeAkL~~~~~p~~~~C~~~yc~~k~~~~wFrLWln~~~liP~~~~C~~D~m~L~YD~~T~~~~N  118 (129)
                      ..++|||||||++||+|+|+.++  .                .+++++|+++....    .|+.++|.++||++|++++|
T Consensus        17 ~~~~PViLvPG~~gS~L~a~~~~--~----------------~~~~~~W~~l~~~~----~~~~~~l~~~yd~~t~~~~~   74 (440)
T PLN02733         17 PDLDPVLLVPGIGGSILNAVDKD--G----------------GNEERVWVRIFAAD----HEFRKKLWSRYDPKTGKTVS   74 (440)
T ss_pred             CCCCcEEEeCCCCcceeEEeecC--C----------------CCccceeEEchhcC----HHHHHHhhheeCcccCceec
Confidence            46999999999999999999642  1                12346666665443    47788888999999999999


Q ss_pred             C-CCcEEeCCC
Q 036994          119 S-PGVETRVPH  128 (129)
Q Consensus       119 ~-pGV~Irvp~  128 (129)
                      . |||+||||+
T Consensus        75 ~~~gv~i~vp~   85 (440)
T PLN02733         75 LDPKTEIVVPD   85 (440)
T ss_pred             CCCCceEEcCC
Confidence            9 799999996


No 3  
>PF02450 LCAT:  Lecithin:cholesterol acyltransferase;  InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2.3.1.43 from EC), is involved in extracellular metabolism of plasma lipoproteins, including cholesterol. It esterifies the free cholesterol transported in plasma lipoproteins, and is activated by apolipoprotein A-I. Defects in LACT cause Norum and Fish eye diseases. This family also includes phospholipid:diacylglycerol acyltransferase (PDAT)(2.3.1.158 from EC), which is involved in triacylglycerol formation by an acyl-CoA independent pathway. The enzyme specifically transfers acyl groups from the sn-2 position of a phospholipid to diacylglycerol, thus forming an sn-1-lysophospholipid [].; GO: 0008374 O-acyltransferase activity, 0006629 lipid metabolic process
Probab=99.22  E-value=7.5e-12  Score=106.14  Aligned_cols=47  Identities=45%  Similarity=0.953  Sum_probs=45.9

Q ss_pred             ceeeecccCCCCCCCcCccccceeEEEcCCCCCccCCCCcEEeCCCC
Q 036994           83 WFRLWFDPSVLLPPFTKCFADRMMLYYDPDLDDFHNSPGVETRVPHF  129 (129)
Q Consensus        83 wFrLWln~~~liP~~~~C~~D~m~L~YD~~T~~~~N~pGV~Irvp~F  129 (129)
                      +|+||+|++.++|+..+||+|+|+|+||++|++++|.|||+||+|||
T Consensus         1 ~~~~W~~~~~~~~~~~~c~~~~~~l~~d~~~~~~~~~~gv~i~~~~~   47 (389)
T PF02450_consen    1 YFELWLNLELFIPRVWDCFFDNMRLVYDPKTWHYSNDPGVEIRVPGF   47 (389)
T ss_pred             CccccCCCcccccccCCcccccceEEEcCCCCceecCCCceeecCCC
Confidence            68999999999999999999999999999999999999999999998


No 4  
>PLN02517 phosphatidylcholine-sterol O-acyltransferase
Probab=99.06  E-value=6.9e-11  Score=106.98  Aligned_cols=72  Identities=26%  Similarity=0.400  Sum_probs=54.8

Q ss_pred             CCcccEEEecCCCCCccEEEeCCCCCCCccccccccccccCCCCceeeecccCCCCCCC-cCccccceeEEEcCCCCCcc
Q 036994           39 RGLHPLILVPGNGGNQLEARLTSDYKPSSLLCNRWYPIVKDSEGWFRLWFDPSVLLPPF-TKCFADRMMLYYDPDLDDFH  117 (129)
Q Consensus        39 ~~~~PVILVPG~gGSqLeAkL~~~~~p~~~~C~~~yc~~k~~~~wFrLWln~~~liP~~-~~C~~D~m~L~YD~~T~~~~  117 (129)
                      .++||||||||+..|+||..-+       ..|+      +. ..+.|||.+....+ .. -+||+|+|+|  |++|+  .
T Consensus        72 ~~khPVVlVPGiiStgLE~W~~-------~~C~------~~-~frkRlWg~~~~~~-~~~~~CWld~m~L--D~~Tg--~  132 (642)
T PLN02517         72 TAKHPVVFVPGIVTGGLELWEG-------HQCA------EG-LFRKRLWGGTFGEV-YKRPLCWVEHMSL--DNETG--L  132 (642)
T ss_pred             CcCCCEEEeCchhhcchhhccC-------cccc------cc-hhhhccccchhhhe-ecCHHHHHHhcee--CCCCC--C
Confidence            3589999999999999996322       2365      32 45679999743322 23 4899999999  99985  5


Q ss_pred             CCCCcEEe-CCCC
Q 036994          118 NSPGVETR-VPHF  129 (129)
Q Consensus       118 N~pGV~Ir-vp~F  129 (129)
                      |+|||+|| ++||
T Consensus       133 dppGVkIRa~~G~  145 (642)
T PLN02517        133 DPPGIRVRAVSGL  145 (642)
T ss_pred             CCCCeEEEecCCh
Confidence            99999999 8776


No 5  
>PF07819 PGAP1:  PGAP1-like protein;  InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT). This is an endoplasmic reticulum membrane protein with a catalytic serine-containing motif that is conserved in a number of lipases. PGAP1 functions as a GPI inositol-deacylase; this deacylation is important for the efficient transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi body [].; GO: 0016788 hydrolase activity, acting on ester bonds, 0006505 GPI anchor metabolic process, 0006886 intracellular protein transport, 0031227 intrinsic to endoplasmic reticulum membrane
Probab=79.94  E-value=1.2  Score=35.45  Aligned_cols=16  Identities=25%  Similarity=0.513  Sum_probs=13.5

Q ss_pred             CcccEEEecCCCCCcc
Q 036994           40 GLHPLILVPGNGGNQL   55 (129)
Q Consensus        40 ~~~PVILVPG~gGSqL   55 (129)
                      ...|||+|||.+||--
T Consensus         3 ~g~pVlFIhG~~Gs~~   18 (225)
T PF07819_consen    3 SGIPVLFIHGNAGSYK   18 (225)
T ss_pred             CCCEEEEECcCCCCHh
Confidence            4679999999999843


No 6  
>TIGR02972 TMAO_torE trimethylamine N-oxide reductase system, TorE protein. Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA.
Probab=73.17  E-value=2.2  Score=27.23  Aligned_cols=20  Identities=35%  Similarity=0.690  Sum_probs=16.8

Q ss_pred             chhhhhhccchHHHHHHHHH
Q 036994           11 DKSEKRKEMKGLRFIVAMSL   30 (129)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~   30 (129)
                      |+++||+|.|-+.||..++.
T Consensus         2 ~~~~k~~El~~flfl~v~l~   21 (47)
T TIGR02972         2 DESKRSNELKALGFIIVVLF   21 (47)
T ss_pred             CcchhHHHHHHHHHHHHHHH
Confidence            67899999999999877654


No 7  
>PF06796 NapE:  Periplasmic nitrate reductase protein NapE;  InterPro: IPR010649 This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides. NapE is thought to be a transmembrane protein [].
Probab=55.00  E-value=12  Score=24.59  Aligned_cols=20  Identities=40%  Similarity=0.657  Sum_probs=16.3

Q ss_pred             chhhhhhccchHHHHHHHHH
Q 036994           11 DKSEKRKEMKGLRFIVAMSL   30 (129)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~   30 (129)
                      ++++||+|.+-++||..++.
T Consensus        10 ~~~~k~~E~~~flfl~~~l~   29 (56)
T PF06796_consen   10 DKSTKRSELKAFLFLAVVLF   29 (56)
T ss_pred             ccchhHHHHHHHHHHHHHHH
Confidence            37889999999998877654


No 8  
>PF04083 Abhydro_lipase:  Partial alpha/beta-hydrolase lipase region;  InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function. The core of each enzyme is similar: an alpha/beta sheet, not barrel, of eight beta-sheets connected by alpha-helices []. This entry represents the N-terminal part of an alpha/beta hydrolase domain found in a number of lipases.; GO: 0006629 lipid metabolic process; PDB: 1K8Q_B 1HLG_B.
Probab=45.07  E-value=14  Score=24.23  Aligned_cols=17  Identities=18%  Similarity=0.241  Sum_probs=9.0

Q ss_pred             CCCcccEEEecCCCCCc
Q 036994           38 SRGLHPLILVPGNGGNQ   54 (129)
Q Consensus        38 ~~~~~PVILVPG~gGSq   54 (129)
                      ...+.||+|..|+++|.
T Consensus        40 ~~~k~pVll~HGL~~ss   56 (63)
T PF04083_consen   40 NKKKPPVLLQHGLLQSS   56 (63)
T ss_dssp             TTT--EEEEE--TT--G
T ss_pred             CCCCCcEEEECCcccCh
Confidence            35688999999999885


No 9  
>PRK11372 lysozyme inhibitor; Provisional
Probab=38.70  E-value=23  Score=25.70  Aligned_cols=19  Identities=37%  Similarity=0.480  Sum_probs=14.8

Q ss_pred             ccchHHHHHHHHHHhhhcC
Q 036994           18 EMKGLRFIVAMSLFCTCQA   36 (129)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~   36 (129)
                      .||+|+.+++.+++..|+.
T Consensus         2 ~mk~ll~~~~~~lL~gCs~   20 (109)
T PRK11372          2 SMKKLLIICLPVLLTGCSA   20 (109)
T ss_pred             chHHHHHHHHHHHHHHhcC
Confidence            5999988888888776654


No 10 
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional
Probab=38.36  E-value=22  Score=26.41  Aligned_cols=13  Identities=23%  Similarity=0.243  Sum_probs=10.8

Q ss_pred             ccEEEecCCCCCc
Q 036994           42 HPLILVPGNGGNQ   54 (129)
Q Consensus        42 ~PVILVPG~gGSq   54 (129)
                      .|||||+|.+||.
T Consensus         3 p~vvllHG~~~~~   15 (242)
T PRK11126          3 PWLVFLHGLLGSG   15 (242)
T ss_pred             CEEEEECCCCCCh
Confidence            4699999999873


No 11 
>PF06028 DUF915:  Alpha/beta hydrolase of unknown function (DUF915);  InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like.; PDB: 3LP5_A 3FLE_A 3DS8_A.
Probab=37.50  E-value=16  Score=29.90  Aligned_cols=16  Identities=31%  Similarity=0.694  Sum_probs=10.9

Q ss_pred             CCcccEEEecCCCCCc
Q 036994           39 RGLHPLILVPGNGGNQ   54 (129)
Q Consensus        39 ~~~~PVILVPG~gGSq   54 (129)
                      ....|+|+|||.+||.
T Consensus         9 ~~~tPTifihG~~gt~   24 (255)
T PF06028_consen    9 QSTTPTIFIHGYGGTA   24 (255)
T ss_dssp             -S-EEEEEE--TTGGC
T ss_pred             cCCCcEEEECCCCCCh
Confidence            4578999999999996


No 12 
>PF15232 DUF4585:  Domain of unknown function (DUF4585)
Probab=36.21  E-value=30  Score=24.08  Aligned_cols=14  Identities=14%  Similarity=0.532  Sum_probs=12.0

Q ss_pred             ceeEEEcCCCCCcc
Q 036994          104 RMMLYYDPDLDDFH  117 (129)
Q Consensus       104 ~m~L~YD~~T~~~~  117 (129)
                      .+|+.||++|++|.
T Consensus        29 ~~k~lfDPETGqYV   42 (75)
T PF15232_consen   29 KTKTLFDPETGQYV   42 (75)
T ss_pred             ceeeeecCCCCcEE
Confidence            47899999999983


No 13 
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase.
Probab=35.82  E-value=24  Score=25.06  Aligned_cols=14  Identities=21%  Similarity=0.271  Sum_probs=11.2

Q ss_pred             ccEEEecCCCCCcc
Q 036994           42 HPLILVPGNGGNQL   55 (129)
Q Consensus        42 ~PVILVPG~gGSqL   55 (129)
                      .|||+++|.+|+.-
T Consensus         2 ~~vv~~hG~~~~~~   15 (251)
T TIGR03695         2 PVLVFLHGFLGSGA   15 (251)
T ss_pred             CEEEEEcCCCCchh
Confidence            57899999888753


No 14 
>PRK10349 carboxylesterase BioH; Provisional
Probab=33.93  E-value=25  Score=26.68  Aligned_cols=13  Identities=38%  Similarity=0.450  Sum_probs=10.8

Q ss_pred             ccEEEecCCCCCc
Q 036994           42 HPLILVPGNGGNQ   54 (129)
Q Consensus        42 ~PVILVPG~gGSq   54 (129)
                      .|||||+|.+++.
T Consensus        14 ~~ivllHG~~~~~   26 (256)
T PRK10349         14 VHLVLLHGWGLNA   26 (256)
T ss_pred             CeEEEECCCCCCh
Confidence            3699999998875


No 15 
>PF06821 Ser_hydrolase:  Serine hydrolase;  InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic. The Crystal Structure Of The Yden Gene Product Swiss:P96671 from B. Subtilis has been solved. The structure shows an alpha-beta hydrolase fold suggesting an enzymatic function for these proteins [].; GO: 0016787 hydrolase activity; PDB: 3BDV_B 2QS9_A 1UXO_A.
Probab=33.85  E-value=25  Score=26.77  Aligned_cols=11  Identities=36%  Similarity=0.872  Sum_probs=7.9

Q ss_pred             EEEecCCCCCc
Q 036994           44 LILVPGNGGNQ   54 (129)
Q Consensus        44 VILVPG~gGSq   54 (129)
                      |++|||.+||.
T Consensus         1 v~IvhG~~~s~   11 (171)
T PF06821_consen    1 VLIVHGYGGSP   11 (171)
T ss_dssp             EEEE--TTSST
T ss_pred             CEEeCCCCCCC
Confidence            78999999986


No 16 
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH. This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown, but is proposed in ref 2. This enzyme belongs to the alpha/beta hydrolase fold family (pfam model pfam00561). Members of this family are restricted to the Proteobacteria.
Probab=33.53  E-value=32  Score=24.56  Aligned_cols=14  Identities=36%  Similarity=0.399  Sum_probs=11.7

Q ss_pred             cccEEEecCCCCCc
Q 036994           41 LHPLILVPGNGGNQ   54 (129)
Q Consensus        41 ~~PVILVPG~gGSq   54 (129)
                      ..|||+++|.+++.
T Consensus         4 ~~~iv~~HG~~~~~   17 (245)
T TIGR01738         4 NVHLVLIHGWGMNA   17 (245)
T ss_pred             CceEEEEcCCCCch
Confidence            46899999998875


No 17 
>PF01674 Lipase_2:  Lipase (class 2);  InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []. This group of lipases has been called class 2 as they are not clearly related to other lipase families, and includes LipA and LipB from Bacillus subtilis [] and uncharacterised proteins from Caenorhabditis.; PDB: 2VTV_B 2X76_A 2X5X_A 2QXU_A 3QMM_A 1I6W_A 3D2C_J 2QXT_B 1R50_A 1T2N_A ....
Probab=32.75  E-value=27  Score=28.06  Aligned_cols=12  Identities=58%  Similarity=1.207  Sum_probs=6.7

Q ss_pred             ccEEEecCCCCC
Q 036994           42 HPLILVPGNGGN   53 (129)
Q Consensus        42 ~PVILVPG~gGS   53 (129)
                      .|||||.|.+++
T Consensus         2 ~PVVlVHG~~~~   13 (219)
T PF01674_consen    2 RPVVLVHGTGGN   13 (219)
T ss_dssp             --EEEE--TTTT
T ss_pred             CCEEEECCCCcc
Confidence            699999999963


No 18 
>PF00975 Thioesterase:  Thioesterase domain;  InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []. Thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates.; GO: 0016788 hydrolase activity, acting on ester bonds, 0009058 biosynthetic process; PDB: 2RON_A 2K2Q_B 3LCR_B 2HFJ_B 1MNQ_A 1MN6_B 1MNA_B 2HFK_B 2H7Y_B 2H7X_A ....
Probab=32.23  E-value=28  Score=25.92  Aligned_cols=14  Identities=36%  Similarity=0.698  Sum_probs=11.2

Q ss_pred             ccEEEecCCCCCcc
Q 036994           42 HPLILVPGNGGNQL   55 (129)
Q Consensus        42 ~PVILVPG~gGSqL   55 (129)
                      .||++|||.+|+..
T Consensus         1 ~~lf~~p~~gG~~~   14 (229)
T PF00975_consen    1 RPLFCFPPAGGSAS   14 (229)
T ss_dssp             -EEEEESSTTCSGG
T ss_pred             CeEEEEcCCccCHH
Confidence            48999999999764


No 19 
>PRK10673 acyl-CoA esterase; Provisional
Probab=31.33  E-value=38  Score=25.28  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=13.5

Q ss_pred             CCcccEEEecCCCCCc
Q 036994           39 RGLHPLILVPGNGGNQ   54 (129)
Q Consensus        39 ~~~~PVILVPG~gGSq   54 (129)
                      ....|||+|+|.+|+.
T Consensus        14 ~~~~~iv~lhG~~~~~   29 (255)
T PRK10673         14 HNNSPIVLVHGLFGSL   29 (255)
T ss_pred             CCCCCEEEECCCCCch
Confidence            4578999999998885


No 20 
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase. This family consists of the polyhydroxyalkanoic acid (PHA) depolymerase of Pseudomonas oleovorans, Pseudomonas putida BM01, and related species. This enzyme is part of polyester storage and mobilization system as in many bacteria. However, species containing this enzyme are unusual in their capacity to produce aromatic polyesters when grown on carbon sources such as benzoic acid or phenylacetic acid.
Probab=31.14  E-value=35  Score=26.40  Aligned_cols=15  Identities=40%  Similarity=0.676  Sum_probs=12.4

Q ss_pred             cccEEEecCCCCCcc
Q 036994           41 LHPLILVPGNGGNQL   55 (129)
Q Consensus        41 ~~PVILVPG~gGSqL   55 (129)
                      ..||||++|.+++.-
T Consensus        25 ~~plvllHG~~~~~~   39 (276)
T TIGR02240        25 LTPLLIFNGIGANLE   39 (276)
T ss_pred             CCcEEEEeCCCcchH
Confidence            479999999998753


No 21 
>PF12695 Abhydrolase_5:  Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A ....
Probab=30.98  E-value=32  Score=23.29  Aligned_cols=12  Identities=33%  Similarity=0.734  Sum_probs=10.2

Q ss_pred             cEEEecCCCCCc
Q 036994           43 PLILVPGNGGNQ   54 (129)
Q Consensus        43 PVILVPG~gGSq   54 (129)
                      |||+++|.+++.
T Consensus         1 ~vv~~HG~~~~~   12 (145)
T PF12695_consen    1 VVVLLHGWGGSR   12 (145)
T ss_dssp             EEEEECTTTTTT
T ss_pred             CEEEECCCCCCH
Confidence            689999999864


No 22 
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]
Probab=28.02  E-value=33  Score=30.21  Aligned_cols=17  Identities=29%  Similarity=0.487  Sum_probs=14.7

Q ss_pred             CCcccEEEecCCCCCcc
Q 036994           39 RGLHPLILVPGNGGNQL   55 (129)
Q Consensus        39 ~~~~PVILVPG~gGSqL   55 (129)
                      ..+.|+|||+|.|+++-
T Consensus        88 ~~~~plVliHGyGAg~g  104 (365)
T KOG4409|consen   88 ANKTPLVLIHGYGAGLG  104 (365)
T ss_pred             cCCCcEEEEeccchhHH
Confidence            56899999999998863


No 23 
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase
Probab=27.65  E-value=47  Score=24.42  Aligned_cols=16  Identities=25%  Similarity=0.291  Sum_probs=12.5

Q ss_pred             CcccEEEecCCCCCcc
Q 036994           40 GLHPLILVPGNGGNQL   55 (129)
Q Consensus        40 ~~~PVILVPG~gGSqL   55 (129)
                      ...|||+++|.+|+.-
T Consensus        24 ~~~~vl~~hG~~g~~~   39 (288)
T TIGR01250        24 EKIKLLLLHGGPGMSH   39 (288)
T ss_pred             CCCeEEEEcCCCCccH
Confidence            3679999999877653


No 24 
>TIGR03611 RutD pyrimidine utilization protein D. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the hydrolase, alpha/beta fold family defined by pfam00067.
Probab=26.18  E-value=49  Score=24.00  Aligned_cols=15  Identities=27%  Similarity=0.468  Sum_probs=12.3

Q ss_pred             CcccEEEecCCCCCc
Q 036994           40 GLHPLILVPGNGGNQ   54 (129)
Q Consensus        40 ~~~PVILVPG~gGSq   54 (129)
                      ...+||+++|.+|+.
T Consensus        12 ~~~~iv~lhG~~~~~   26 (257)
T TIGR03611        12 DAPVVVLSSGLGGSG   26 (257)
T ss_pred             CCCEEEEEcCCCcch
Confidence            356899999999985


No 25 
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=26.09  E-value=52  Score=25.50  Aligned_cols=22  Identities=36%  Similarity=0.570  Sum_probs=16.8

Q ss_pred             ceeEEEcCCCCCccCCCCcEEeC
Q 036994          104 RMMLYYDPDLDDFHNSPGVETRV  126 (129)
Q Consensus       104 ~m~L~YD~~T~~~~N~pGV~Irv  126 (129)
                      ...+.||+++++.-+..| +|||
T Consensus       124 f~~~~YDP~~k~l~~~~g-eirv  145 (164)
T cd04709         124 FYSLVYDPEQKTLLADQG-EIRV  145 (164)
T ss_pred             EEEEEECCCCCeecccce-eEEe
Confidence            358899999998866655 6765


No 26 
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]
Probab=25.96  E-value=47  Score=26.61  Aligned_cols=14  Identities=36%  Similarity=0.916  Sum_probs=11.7

Q ss_pred             cccEEEecCCCCCc
Q 036994           41 LHPLILVPGNGGNQ   54 (129)
Q Consensus        41 ~~PVILVPG~gGSq   54 (129)
                      ...||+|||.+||.
T Consensus         2 ~~~~lIVpG~~~Sg   15 (181)
T COG3545           2 MTDVLIVPGYGGSG   15 (181)
T ss_pred             CceEEEecCCCCCC
Confidence            34689999999985


No 27 
>PRK03592 haloalkane dehalogenase; Provisional
Probab=25.31  E-value=51  Score=25.67  Aligned_cols=15  Identities=20%  Similarity=0.450  Sum_probs=12.3

Q ss_pred             CcccEEEecCCCCCc
Q 036994           40 GLHPLILVPGNGGNQ   54 (129)
Q Consensus        40 ~~~PVILVPG~gGSq   54 (129)
                      ...|||||+|.++|.
T Consensus        26 ~g~~vvllHG~~~~~   40 (295)
T PRK03592         26 EGDPIVFLHGNPTSS   40 (295)
T ss_pred             CCCEEEEECCCCCCH
Confidence            347999999998884


No 28 
>PF12697 Abhydrolase_6:  Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A ....
Probab=25.24  E-value=48  Score=23.07  Aligned_cols=11  Identities=27%  Similarity=0.770  Sum_probs=9.0

Q ss_pred             EEEecCCCCCc
Q 036994           44 LILVPGNGGNQ   54 (129)
Q Consensus        44 VILVPG~gGSq   54 (129)
                      ||||+|.+++.
T Consensus         1 vv~~hG~~~~~   11 (228)
T PF12697_consen    1 VVFLHGFGGSS   11 (228)
T ss_dssp             EEEE-STTTTG
T ss_pred             eEEECCCCCCH
Confidence            79999999988


No 29 
>PLN02606 palmitoyl-protein thioesterase
Probab=25.15  E-value=1e+02  Score=26.39  Aligned_cols=13  Identities=31%  Similarity=0.439  Sum_probs=11.3

Q ss_pred             CCcccEEEecCCC
Q 036994           39 RGLHPLILVPGNG   51 (129)
Q Consensus        39 ~~~~PVILVPG~g   51 (129)
                      +.--|||+..|+|
T Consensus        24 ~~~~PvViwHGlg   36 (306)
T PLN02606         24 SLSVPFVLFHGFG   36 (306)
T ss_pred             CCCCCEEEECCCC
Confidence            4568999999999


No 30 
>PF08414 NADPH_Ox:  Respiratory burst NADPH oxidase;  InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.
Probab=25.01  E-value=31  Score=25.17  Aligned_cols=18  Identities=50%  Similarity=0.831  Sum_probs=12.8

Q ss_pred             CcchhhhhhccchHHHHH
Q 036994            9 SRDKSEKRKEMKGLRFIV   26 (129)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~   26 (129)
                      .|.+|-...-.|||+||-
T Consensus         3 dRt~S~A~~ALkGLrFIs   20 (100)
T PF08414_consen    3 DRTKSGAQRALKGLRFIS   20 (100)
T ss_dssp             ---HHHHHHHHHHHHHHH
T ss_pred             CcchhHHHHHHhccccee
Confidence            467787888899999984


No 31 
>TIGR02973 nitrate_rd_NapE periplasmic nitrate reductase, NapE protein. NapE, homologous to TorE (TIGR02972), is a membrane protein of unknown function that is part of the periplasmic nitrate reductase system; it may be part of the enzyme complex. The periplasmic nitrate reductase allows for nitrate respiration in anaerobic conditions.
Probab=24.55  E-value=46  Score=20.74  Aligned_cols=16  Identities=31%  Similarity=0.497  Sum_probs=12.4

Q ss_pred             hhhccchHHHHHHHHH
Q 036994           15 KRKEMKGLRFIVAMSL   30 (129)
Q Consensus        15 ~~~~~~~~~~~~~~~~   30 (129)
                      ||+|.+-+.||..++.
T Consensus         1 k~~El~~flfl~~~l~   16 (42)
T TIGR02973         1 KRMELNTFLFLAAVIW   16 (42)
T ss_pred             CcHHHHHHHHHHHHHH
Confidence            6789998888876654


No 32 
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase. Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Probab=23.97  E-value=59  Score=24.75  Aligned_cols=15  Identities=20%  Similarity=0.406  Sum_probs=12.0

Q ss_pred             CcccEEEecCCCCCc
Q 036994           40 GLHPLILVPGNGGNQ   54 (129)
Q Consensus        40 ~~~PVILVPG~gGSq   54 (129)
                      ...||||++|.+++.
T Consensus        29 ~~~~ivllHG~~~~~   43 (282)
T TIGR03343        29 NGEAVIMLHGGGPGA   43 (282)
T ss_pred             CCCeEEEECCCCCch
Confidence            457999999998764


No 33 
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=23.91  E-value=74  Score=24.87  Aligned_cols=18  Identities=22%  Similarity=0.552  Sum_probs=13.0

Q ss_pred             cchHHHHHHHHHHhhhcC
Q 036994           19 MKGLRFIVAMSLFCTCQA   36 (129)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~   36 (129)
                      ||=+.+|++++++.+|+.
T Consensus         1 mk~i~~l~l~lll~~C~~   18 (216)
T PF11153_consen    1 MKKILLLLLLLLLTGCST   18 (216)
T ss_pred             ChHHHHHHHHHHHHhhcC
Confidence            677788877777777755


No 34 
>PF10049 DUF2283:  Protein of unknown function (DUF2283);  InterPro: IPR019270  Members of this family of hypothetical proteins have no known function. 
Probab=22.96  E-value=50  Score=20.41  Aligned_cols=11  Identities=45%  Similarity=0.878  Sum_probs=8.8

Q ss_pred             eeEEEcCCCCC
Q 036994          105 MMLYYDPDLDD  115 (129)
Q Consensus       105 m~L~YD~~T~~  115 (129)
                      |++.||++++.
T Consensus         1 Mki~YD~~~D~   11 (50)
T PF10049_consen    1 MKIEYDPEADA   11 (50)
T ss_pred             CEeEEcCcCCE
Confidence            78889988764


No 35 
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein. Members of this family belong to the alpha/beta fold family hydrolases (PFAM model pfam00561). Members are found in bacterial genomes if and only if they encoded for anoxygenic photosynthetic systems similar to that of Rhodobacter capsulatus and other alpha-Proteobacteria. Members often are encoded in the same operon as subunits of the protoporphyrin IX magnesium chelatase, and were once designated BchO. No literature supports a role as an actual subunit of magnesium chelatase, but an accessory role is possible, as suggested by placement by its probable hydrolase activity.
Probab=22.17  E-value=65  Score=24.06  Aligned_cols=15  Identities=27%  Similarity=0.377  Sum_probs=12.6

Q ss_pred             cccEEEecCCCCCcc
Q 036994           41 LHPLILVPGNGGNQL   55 (129)
Q Consensus        41 ~~PVILVPG~gGSqL   55 (129)
                      ..|||+++|.+|+..
T Consensus        28 ~~~vv~~hG~~~~~~   42 (278)
T TIGR03056        28 GPLLLLLHGTGASTH   42 (278)
T ss_pred             CCeEEEEcCCCCCHH
Confidence            579999999998763


No 36 
>PLN02578 hydrolase
Probab=21.16  E-value=70  Score=26.26  Aligned_cols=13  Identities=31%  Similarity=0.741  Sum_probs=11.4

Q ss_pred             ccEEEecCCCCCc
Q 036994           42 HPLILVPGNGGNQ   54 (129)
Q Consensus        42 ~PVILVPG~gGSq   54 (129)
                      .|||||+|.+++.
T Consensus        87 ~~vvliHG~~~~~   99 (354)
T PLN02578         87 LPIVLIHGFGASA   99 (354)
T ss_pred             CeEEEECCCCCCH
Confidence            4999999999974


No 37 
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]
Probab=20.73  E-value=1.1e+02  Score=25.63  Aligned_cols=15  Identities=40%  Similarity=0.758  Sum_probs=11.5

Q ss_pred             CcccEEEecCCCCCc
Q 036994           40 GLHPLILVPGNGGNQ   54 (129)
Q Consensus        40 ~~~PVILVPG~gGSq   54 (129)
                      ...|||+|||++++-
T Consensus        58 ~~~pivlVhG~~~~~   72 (336)
T COG1075          58 AKEPIVLVHGLGGGY   72 (336)
T ss_pred             CCceEEEEccCcCCc
Confidence            366999999986553


No 38 
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones]
Probab=20.20  E-value=1.2e+02  Score=26.02  Aligned_cols=19  Identities=26%  Similarity=0.282  Sum_probs=14.4

Q ss_pred             CCCcccEEEecCCCCCccE
Q 036994           38 SRGLHPLILVPGNGGNQLE   56 (129)
Q Consensus        38 ~~~~~PVILVPG~gGSqLe   56 (129)
                      +.+-.|+|++.|++.+-=.
T Consensus        20 s~s~~P~ii~HGigd~c~~   38 (296)
T KOG2541|consen   20 SPSPVPVIVWHGIGDSCSS   38 (296)
T ss_pred             CcccCCEEEEeccCccccc
Confidence            3444899999999977644


No 39 
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]
Probab=20.15  E-value=56  Score=32.05  Aligned_cols=18  Identities=28%  Similarity=0.650  Sum_probs=13.9

Q ss_pred             CcccEEEecCCCCCccEE
Q 036994           40 GLHPLILVPGNGGNQLEA   57 (129)
Q Consensus        40 ~~~PVILVPG~gGSqLeA   57 (129)
                      +.=||.+|||..||-=++
T Consensus        88 sGIPVLFIPGNAGSyKQv  105 (973)
T KOG3724|consen   88 SGIPVLFIPGNAGSYKQV  105 (973)
T ss_pred             CCceEEEecCCCCchHHH
Confidence            345999999999995433


Done!