Citrus Sinensis ID: 037010


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------59
MKQLCMIFFVLIVPSLISVTVESKCTKGCDTALASYYVWIGSNLTFIAQTLRSSLVDPNDVELTTILSYNKQLSNKDSLLADTRINVPFPCDCINGEFLGHTFQFSINSGDTYEKVATRYYSNLTDAASLQRINNYPPTRIPDRGTLNVTVNCSCGDADVSKQYRLFVTYPLRPGDSLQSIARNVGLSESLLQNYNPGVNFTRGSGLVFIPGRDANGVFPALESSSTGGLVFPAYKTVESTGPAAGTPTSLNAITVDKSVEFSYEELSKATDNFSMSHKIGQGGFGAVYYAELRGEYGNSYLSRLICVNLLMQKAAIKKMDMQASREFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEYIENGNLSEHLRGSGRDPLPWSSRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFHAKVADFGLTKLTEVGSASLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKGNGSSADSKGLVALFEEVLNLPDPIEDLRKLVDPRLGDNCPLDSVLKMAQLAKVCTQEYPQLRPSMRSIVVALMTLSSTTEDWDVGSFYENHALVNLMSGR
ccccHHHHHHHHHHHccEEECccccccccHHHHHEEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccCEEEEECcccccccCEEEEEEEECcccccccccccccccccccHHHHHHcccccccccccccEEEEEEccccccccccccccEEEEECcccccccHHHHHHccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHcccccccccccccccEEEEEEEcccccccccccEEEEEEHHHHHHHHHccccHHHHHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEccccHHHHHcccccccccHHHHHHHHHHHcHHHHHHcccccccCECcccccccEEcccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccccccccccccccccEEccccc
***LCMIFFVLIVPSLISVTVESKCTKGCDTALASYYVWIGSNLTFIAQTLRSSLVDPNDVELTTILSYNKQLSNKDSLLADTRINVPFPCDCINGEFLGHTFQFSINSGDTYEKVATRYYSNLTDAASLQRINNYPPTRIPDRGTLNVTVNCSCGDADVSKQYRLFVTYPLRPGDSLQSIARNVGLSESLLQNYNPGVNFTRGSGLVFIPGRDANGVFPALESSSTGGLVFPAYK*******************VDKSVEFSYEELSKATDNFSMSHKIGQGGFGAVYYAELRGEYGNSYLSRLICVNLLMQKAAIKKMDMQASREFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEYIENGNLSEHLRGSGRDPLPWSSRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFHAKVADFGLTKLTEVGSASLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKGNGS*ADSKGLVALFEEVLNLPDPIEDLRKLVDPRLGDNCPLDSVLKMAQLAKVCTQEYPQLRPSMRSIVVALMTLS************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQLCMIFFVLIVPSLISVTVESKCTKGCDTALASYYVWIGSNLTFIAQTLRSSLVDPNDVELTTILSYNKQLSNKDSLLADTRINVPFPCDCINGEFLGHTFQFSINSGDTYEKVATRYYSNLTDAASLQRINNYPPTRIPDRGTLNVTVNCSCGDADVSKQYRLFVTYPLRPGDSLQSIARNVGLSESLLQNYNPGVNFTRGSGLVFIPGRDANGVFPALESSSTGGLVFPAYKTVESTGPAAGTPTSLNAITVDKSVEFSYEELSKATDNFSMSHKIGQGGFGAVYYAELRGEYGNSYLSRLICVNLLMQKAAIKKMDMQASREFLAELKVLTHVHHLNLVRLIGYCVEGSLFLVYEYIENGNLSEHLRGSGRDPLPWSSRVQIALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNFHAKVADFGLTKLTEVGSASLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVLYELISAKEAIVKGNGSSADSKGLVALFEEVLNLPDPIEDLRKLVDPRLGDNCPLDSVLKMAQLAKVCTQEYPQLRPSMRSIVVALMTLSSTTEDWDVGSFYENHALVNLMSGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chitin elicitor receptor kinase 1 Plays an essential role in detecting peptidoglycans (e.g. PGNs) and restricting bacterial growth. Recognizes microbe-derived N-acetylglucosamine (NAG)-containing ligands (By similarity). Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to both biotic and abiotic stresses. Involved in the resistance to pathogenic fungi, probably by sensing microbe-associated molecular patterns (MAMP) and pathogen-associated molecular patterns (PAMP).probableD7UPN3
Chitin elicitor receptor kinase 1 Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity toward both biotic and abiotic stresses (e.g. tolerance to salinity, heavy-metal stresses, and Botrytis cinerea infection). Recognizes microbe-derived N-acetylglucosamine (NAG)-containing ligands. Involved in the resistance to pathogenic fungi Alternaria brassicicola and Erysiphe cichoracearum, probably by sensing microbe-associated molecular patterns (MAMP) and pathogen-associated molecular patterns (PAMP). Plays an essential role in detecting peptidoglycans (e.g. PGNs) and restricting bacterial growth. Target of the bacterial type III effector E3-ligase protein hopAB2/avrPtoB of Pseudomonas syringae pv. tomato DC3000 that mediates ubiquitination and subsequent proteolysis, thus blocking all defense responses by suppressing PAMP-triggered immunity (PTI).probableA8R7E6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EBY, chain A
Confidence level:very confident
Coverage over the Query: 25-224
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 257-308,324-565
View the alignment between query and template
View the model in PyMOL
Template: 3TT0, chain A
Confidence level:very confident
Coverage over the Query: 270-507,518-572
View the alignment between query and template
View the model in PyMOL
Template: 3T8O, chain A
Confidence level:probable
Coverage over the Query: 229-511
View the alignment between query and template
View the model in PyMOL