Citrus Sinensis ID: 037011


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MAKAKLVFVLLVAALFSISIVMATETQNLLDTNGYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKSGGPKCP
cHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccc
***AKLVFVLLVAALFSISIVMATE**************LKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKT********
xxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKAKLVFVLLVAALFSISIVMATETQNLLDTNGYGPGSLKSYQCPSQCTRRCSQTQYHKPCMFFCQKCCAKCLCVPPGFYGNKAVCPCYNNWKTKSGGPKCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin-regulated protein 6 Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.probableQ6NMQ7
Protein GAST1 probableP27057
Protein RSI-1 probableP47926

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted