BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037071
         (208 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1WX0|A Chain A, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|B Chain B, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|C Chain C, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|D Chain D, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|E Chain E, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|F Chain F, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|G Chain G, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|H Chain H, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|I Chain I, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
 pdb|1WX0|J Chain J, Crystal Structure Of Transaldolase From Thermus
           Thermophilus Hb8
          Length = 223

 Score = 27.3 bits (59), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 43  GAPYSIKASLCCNYKPGLLSDLRRVLEALHLSIVKAEIATLEGSMKNIFVMASCKELNFE 102
           G P S  A +       ++++ RR L A+H +IV     T EG       + +CK L+ E
Sbjct: 60  GGPVS--AEVTALEAEAMVAEGRR-LAAIHPNIVVKLPTTEEG-------LKACKRLSAE 109

Query: 103 NTEVCQSLVSSVHQAIRSVLDKFSATEEFL 132
             +V  +L+ S +QA+ +     S    FL
Sbjct: 110 GIKVNMTLIFSANQALLAARAGASYVSPFL 139


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,599,844
Number of Sequences: 62578
Number of extensions: 147134
Number of successful extensions: 396
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 396
Number of HSP's gapped (non-prelim): 1
length of query: 208
length of database: 14,973,337
effective HSP length: 94
effective length of query: 114
effective length of database: 9,091,005
effective search space: 1036374570
effective search space used: 1036374570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)