Query         037083
Match_columns 147
No_of_seqs    151 out of 221
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 08:28:51 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037083.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037083hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04885 Stig1:  Stigma-specifi 100.0 1.4E-37 3.1E-42  240.0   7.6   94   46-147    40-136 (136)
  2 PF04885 Stig1:  Stigma-specifi  99.2 9.8E-12 2.1E-16   96.4   5.6   52   94-146    56-107 (136)
  3 PF02950 Conotoxin:  Conotoxin;  89.8    0.17 3.7E-06   34.1   1.2   23   65-89     48-70  (75)
  4 PF07172 GRP:  Glycine rich pro  89.0    0.36 7.8E-06   35.4   2.5   21    1-22      1-21  (95)
  5 PF07172 GRP:  Glycine rich pro  75.5       3 6.5E-05   30.5   2.8   22    2-23      5-26  (95)
  6 PF15284 PAGK:  Phage-encoded v  66.3       6 0.00013   27.3   2.4   23    1-23      1-23  (61)
  7 PRK12750 cpxP periplasmic repr  57.8      11 0.00024   30.0   3.0   21    1-21      1-21  (170)
  8 PRK13791 lysozyme inhibitor; P  57.5      13 0.00029   28.1   3.2   21    1-21      1-21  (113)
  9 COG4808 Uncharacterized protei  56.8      12 0.00026   30.0   2.9   23    1-23      1-23  (152)
 10 PF11912 DUF3430:  Protein of u  55.2      11 0.00023   29.5   2.5   14    1-14      1-14  (212)
 11 PF10880 DUF2673:  Protein of u  53.3      13 0.00028   25.7   2.3   13    1-13      1-14  (65)
 12 PF06357 Omega-toxin:  Omega-at  48.5      11 0.00023   23.7   1.1   17  130-146     8-24  (37)
 13 PF05453 Toxin_6:  BmTXKS1/BmP0  46.8     6.2 0.00013   23.4  -0.1   24   66-89      2-25  (28)
 14 PF05968 Bacillus_PapR:  Bacill  45.6      21 0.00046   23.5   2.3   21    1-21      1-21  (48)
 15 PF03823 Neurokinin_B:  Neuroki  44.9      19 0.00042   24.7   2.1   27    4-30      1-27  (59)
 16 PLN02159 Fe(2+) transport prot  43.4      19 0.00041   31.7   2.3   23    1-23      1-23  (337)
 17 MTH00042 ND3 NADH dehydrogenas  43.3      45 0.00097   24.8   4.1   18    1-18      1-18  (116)
 18 PF10717 ODV-E18:  Occlusion-de  42.5      39 0.00084   24.8   3.5   25    3-27     27-51  (85)
 19 MTH00012 ND3 NADH dehydrogenas  42.3      50  0.0011   24.6   4.2   18    1-18      1-18  (117)
 20 PF12798 Fer4_3:  4Fe-4S bindin  41.9     7.9 0.00017   19.5  -0.1   12  125-136     3-14  (15)
 21 PF12930 DUF3836:  Family of un  41.5     9.9 0.00021   29.3   0.3   22    3-24      6-27  (132)
 22 PF08087 Toxin_18:  Conotoxin O  41.3      12 0.00025   22.6   0.5   18  102-119     7-24  (31)
 23 PHA02706 hypothetical protein;  41.0      30 0.00065   23.3   2.5   22    1-22      1-22  (58)
 24 PF11912 DUF3430:  Protein of u  41.0      19 0.00042   28.1   1.9   18    4-21      1-18  (212)
 25 TIGR02163 napH_ ferredoxin-typ  39.7      13 0.00029   30.8   0.8   40   96-136   204-249 (255)
 26 TIGR02209 ftsL_broad cell divi  39.2      44 0.00095   22.6   3.2   16    1-16      1-16  (85)
 27 PF08105 Antimicrobial10:  Metc  38.9      42 0.00091   22.5   2.9    7   49-55     37-43  (52)
 28 PRK09477 napH quinol dehydroge  38.9      18  0.0004   30.2   1.6   41   96-136   211-257 (271)
 29 PF12354 Internalin_N:  Bacteri  38.5      13 0.00027   25.0   0.4   28    3-30      6-33  (57)
 30 PF05436 MF_alpha_N:  Mating fa  38.4      34 0.00073   25.1   2.6   14    1-14      1-14  (86)
 31 PF08194 DIM:  DIM protein;  In  38.0      28 0.00061   21.7   1.9   12    1-12      1-12  (36)
 32 PF12071 DUF3551:  Protein of u  37.8      42  0.0009   24.0   3.0    7   66-72     63-69  (82)
 33 smart00289 WR1 Worm-specific r  37.3      29 0.00063   20.1   1.8   26  118-144     8-36  (38)
 34 TIGR02184 Myco_arth_vir_N Myco  37.2      21 0.00046   21.9   1.2   16    7-22     11-26  (33)
 35 PRK13728 conjugal transfer pro  35.9      26 0.00057   28.3   2.0   21    1-21      1-21  (181)
 36 PF04060 FeS:  Putative Fe-S cl  35.8      13 0.00028   22.4   0.2   10   95-104     4-13  (35)
 37 PF05538 Campylo_MOMP:  Campylo  35.7      23 0.00051   32.6   1.8   14    1-14      1-14  (431)
 38 PF12869 tRNA_anti-like:  tRNA_  35.4      12 0.00027   27.4   0.0   21    1-21      1-22  (144)
 39 PRK14864 putative biofilm stre  35.0      41 0.00089   25.2   2.7   19    1-19      2-20  (104)
 40 PF15240 Pro-rich:  Proline-ric  34.8      31 0.00067   28.3   2.2   22    4-25      1-22  (179)
 41 PRK10081 entericidin B membran  34.6      60  0.0013   21.4   3.1   17    5-21      4-20  (48)
 42 PRK12450 foldase protein PrsA;  34.5      44 0.00096   28.5   3.2   23    1-23      1-23  (309)
 43 PRK00059 prsA peptidylprolyl i  34.1      39 0.00086   28.4   2.8   22    1-22      1-22  (336)
 44 PF02402 Lysis_col:  Lysis prot  33.3      13 0.00028   24.3  -0.2   13    1-15      1-13  (46)
 45 TIGR03379 glycerol3P_GlpC glyc  32.3      31 0.00067   29.8   1.9   39   96-136     8-67  (397)
 46 PF09716 ETRAMP:  Malarial earl  31.9      45 0.00097   23.7   2.4   19    1-19      1-19  (84)
 47 PRK04405 prsA peptidylprolyl i  31.4      52  0.0011   28.0   3.2   22    1-22      1-23  (298)
 48 PF10916 DUF2712:  Protein of u  30.7      67  0.0015   25.7   3.4   16    3-18      4-19  (146)
 49 COG3111 Periplasmic protein wi  30.6      48   0.001   26.0   2.5   21    1-21      1-21  (128)
 50 COG5510 Predicted small secret  30.4      73  0.0016   20.7   2.9   19    4-22      3-21  (44)
 51 PF09065 Haemadin:  Haemadin;    30.0      15 0.00032   21.3  -0.3   15  131-145     6-20  (27)
 52 PRK13681 hypothetical protein;  29.7      53  0.0012   20.4   2.1   14    1-14      1-14  (35)
 53 cd00925 Cyt_c_Oxidase_VIa Cyto  29.6      57  0.0012   23.7   2.6   20    2-21     14-33  (86)
 54 PF05782 ECM1:  Extracellular m  29.4      94   0.002   29.5   4.6   23    1-23      1-23  (544)
 55 PF00037 Fer4:  4Fe-4S binding   29.4      14  0.0003   20.2  -0.5   12  125-136    10-21  (24)
 56 PF14608 zf-CCCH_2:  Zinc finge  29.2      39 0.00085   17.7   1.3   14  133-146     2-16  (19)
 57 PF04706 Dickkopf_N:  Dickkopf   28.5      35 0.00075   22.6   1.2   31  114-145    21-51  (52)
 58 PF07403 DUF1505:  Protein of u  27.8      34 0.00073   26.3   1.2   16   10-25      7-22  (114)
 59 TIGR01495 ETRAMP Plasmodium ri  27.7      55  0.0012   23.6   2.3   17    1-17      1-17  (85)
 60 PF05170 AsmA:  AsmA family;  I  27.5      65  0.0014   29.3   3.2   18    1-18      1-19  (604)
 61 PRK13183 psbN photosystem II r  27.3      89  0.0019   20.5   3.0    7   32-38     38-44  (46)
 62 PF01683 EB:  EB module;  Inter  26.9      78  0.0017   19.6   2.7   40  105-145     1-40  (52)
 63 TIGR01710 typeII_sec_gspG gene  26.8      62  0.0014   24.2   2.5   19    2-20      7-25  (134)
 64 PRK04517 hypothetical protein;  26.7      46   0.001   27.3   1.9   14    1-14      1-14  (216)
 65 PRK11168 glpC sn-glycerol-3-ph  26.7      57  0.0012   28.0   2.6   41   96-136    10-69  (396)
 66 PF10907 DUF2749:  Protein of u  26.0      21 0.00046   25.0  -0.1    7   50-56     43-49  (66)
 67 PRK01904 hypothetical protein;  26.0      68  0.0015   26.3   2.8   13    1-13      1-13  (219)
 68 COG3470 Tpd Uncharacterized pr  25.9      76  0.0017   26.0   3.0   20    1-20      1-20  (179)
 69 PF11777 DUF3316:  Protein of u  25.5      63  0.0014   23.7   2.3   10    5-14      2-11  (114)
 70 MTH00203 ND3 NADH dehydrogenas  25.1 1.3E+02  0.0029   22.0   4.0   18    1-18      1-18  (112)
 71 PF08139 LPAM_1:  Prokaryotic m  24.9      85  0.0018   18.0   2.3   13    2-14      5-17  (25)
 72 PRK14494 putative molybdopteri  24.7      29 0.00064   28.8   0.5   15   92-106   147-161 (229)
 73 smart00608 ACR ADAM Cysteine-R  24.7      45 0.00097   25.5   1.4   18  102-119   120-137 (137)
 74 TIGR02494 PFLE_PFLC glycyl-rad  24.6      35 0.00076   28.1   0.9   39   97-136    52-97  (295)
 75 COG3137 Putative salt-induced   24.5      55  0.0012   28.3   2.1   10   31-40     46-55  (262)
 76 PF15330 SIT:  SHP2-interacting  24.0      95  0.0021   23.2   3.0   18    4-21      3-20  (107)
 77 PF11337 DUF3139:  Protein of u  23.4   1E+02  0.0022   21.4   3.0   15    1-15      1-15  (85)
 78 PF09610 Myco_arth_vir_N:  Myco  23.1      45 0.00099   20.5   0.9   16    7-22     11-26  (33)
 79 PF11137 DUF2909:  Protein of u  23.0 1.1E+02  0.0025   20.9   3.0   22    1-22      1-22  (63)
 80 PF04835 Pox_A9:  A9 protein co  22.3 1.5E+02  0.0032   20.1   3.4   23    3-25     26-48  (54)
 81 PRK11636 mrcA penicillin-bindi  22.1      89  0.0019   30.9   3.2   17    1-17      1-17  (850)
 82 CHL00020 psbN photosystem II p  22.1      99  0.0021   20.0   2.4    7   32-38     35-41  (43)
 83 PRK15205 long polar fimbrial p  21.8      77  0.0017   24.5   2.3   14    1-14      1-14  (176)
 84 PF00879 Defensin_propep:  Defe  21.8 1.1E+02  0.0023   20.5   2.6   19    4-22      1-19  (52)
 85 PF01599 Ribosomal_S27:  Riboso  21.2      40 0.00087   22.0   0.5   14   90-103    33-46  (47)
 86 PF12800 Fer4_4:  4Fe-4S bindin  21.2      53  0.0012   16.7   0.9    9  126-134     7-15  (17)
 87 PRK09810 entericidin A; Provis  21.1   1E+02  0.0023   19.6   2.4   11    4-14      2-12  (41)
 88 PF12782 Innate_immun:  Inverte  21.0      33 0.00072   29.6   0.1   18    5-22      4-21  (311)
 89 PRK15307 major fimbrial protei  20.8      97  0.0021   24.7   2.7   16    1-16      1-16  (201)
 90 PRK09474 malE maltose ABC tran  20.8 1.3E+02  0.0027   25.3   3.5   21    1-21      1-21  (396)
 91 PF07790 DUF1628:  Protein of u  20.7 1.3E+02  0.0028   20.3   3.0   12    7-18     10-21  (80)
 92 PF07835 COX4_pro_2:  Bacterial  20.5   1E+02  0.0023   19.5   2.3   18    2-19     23-40  (44)
 93 PF08116 Toxin_29:  PhTx neurot  20.5      32 0.00069   20.8  -0.1   14  103-116     8-21  (31)
 94 PF08091 Toxin_21:  Spider inse  20.4      43 0.00094   21.2   0.5    9   82-90     13-21  (39)
 95 PHA02291 hypothetical protein   20.4      98  0.0021   24.1   2.5   21    1-21      1-21  (132)
 96 PRK06273 ferredoxin; Provision  20.3      39 0.00085   26.7   0.4   12  125-136    95-106 (165)

No 1  
>PF04885 Stig1:  Stigma-specific protein, Stig1;  InterPro: IPR006969 This family represents the Stig1 cysteine rich plant protein.The tobacco stigma-specific gene, STIG1 is developmentally regulated and expressed specifically in the stigmatic secretory zone. Pistils of transgenic STIG1-barnase tobacco plants undergo normal development, but lack the stigmatic secretory zone and are female sterile. Pollen grains are unable to penetrate the surface of the ablated pistils. Application of stigmatic exudate from wild-type pistils to the ablated surface increases the efficiency of pollen tube germination and growth and restores the capacity of pollen tubes to penetrate the style []. The function of STIG1 is unknown.
Probab=100.00  E-value=1.4e-37  Score=240.00  Aligned_cols=94  Identities=59%  Similarity=1.241  Sum_probs=89.0

Q ss_pred             CCCCCcchhhhhccCCccccccccccccccCc---CccccccCccccccccCCCcchhcccCCCCCccccCCccccCccC
Q 037083           46 PSKRGSRFLAEADKNPRAADHCHKDNEVCSLF---GRNSTCCNNKCMDLSTDDKNCGACKKKCKFTEACCRGQCVNLSFD  122 (147)
Q Consensus        46 ~~~r~srfLa~~~~~~~~~~~C~~~~~iC~~~---~~g~~cC~~~Cvd~~tD~~NCG~Cg~~C~~g~~CC~G~Cvdl~~D  122 (147)
                      .+.+++|||++        ++|+++|+||..+   ++|++||+++|||+.+|++|||+||++|+++++||+|+|||+.+|
T Consensus        40 ~~~~~~~~~~~--------~~C~~~~~iC~~~~~~~~~~~CC~~~Cvdv~~d~~nCG~Cg~~C~~g~~cC~G~Cvd~~~d  111 (136)
T PF04885_consen   40 VSSRPSRFLAH--------DTCNKDPWICSAKGKCSPGPTCCNNKCVDVSSDRNNCGACGNKCPYGQTCCGGQCVDLNSD  111 (136)
T ss_pred             ccCCccccccc--------cccCCCchhhcCCCCCCCCCcccCCcCCccCCCccccHhhcCCCCCCceecCCEeECCCCC
Confidence            34567788866        8999999999999   789999999999999999999999999999999999999999999


Q ss_pred             CCcchhcCcCCCCCCccCCceecCC
Q 037083          123 KRHCGRCNNRCEKGQFCVYGMCDYA  147 (147)
Q Consensus       123 ~~nCG~Cg~~C~~g~~C~~G~C~ya  147 (147)
                      ++|||+||++|+.|+.|++|+|.||
T Consensus       112 ~~~CG~Cg~~C~~G~~C~~G~C~ya  136 (136)
T PF04885_consen  112 PRHCGACGNKCPPGQKCVYGMCGYA  136 (136)
T ss_pred             ccccCCCCCcCCCcCCcCCeECCCC
Confidence            9999999999999999999999998


No 2  
>PF04885 Stig1:  Stigma-specific protein, Stig1;  InterPro: IPR006969 This family represents the Stig1 cysteine rich plant protein.The tobacco stigma-specific gene, STIG1 is developmentally regulated and expressed specifically in the stigmatic secretory zone. Pistils of transgenic STIG1-barnase tobacco plants undergo normal development, but lack the stigmatic secretory zone and are female sterile. Pollen grains are unable to penetrate the surface of the ablated pistils. Application of stigmatic exudate from wild-type pistils to the ablated surface increases the efficiency of pollen tube germination and growth and restores the capacity of pollen tubes to penetrate the style []. The function of STIG1 is unknown.
Probab=99.25  E-value=9.8e-12  Score=96.41  Aligned_cols=52  Identities=40%  Similarity=0.905  Sum_probs=47.6

Q ss_pred             CCCcchhcccCCCCCccccCCccccCccCCCcchhcCcCCCCCCccCCceecC
Q 037083           94 DDKNCGACKKKCKFTEACCRGQCVNLSFDKRHCGRCNNRCEKGQFCVYGMCDY  146 (147)
Q Consensus        94 D~~NCG~Cg~~C~~g~~CC~G~Cvdl~~D~~nCG~Cg~~C~~g~~C~~G~C~y  146 (147)
                      ++.-|..-+ ....+.+||+++|||+.+|++|||.||++|+.|+.|..|.|++
T Consensus        56 ~~~iC~~~~-~~~~~~~CC~~~Cvdv~~d~~nCG~Cg~~C~~g~~cC~G~Cvd  107 (136)
T PF04885_consen   56 DPWICSAKG-KCSPGPTCCNNKCVDVSSDRNNCGACGNKCPYGQTCCGGQCVD  107 (136)
T ss_pred             CchhhcCCC-CCCCCCcccCCcCCccCCCccccHhhcCCCCCCceecCCEeEC
Confidence            666777777 7788999999999999999999999999999999999999975


No 3  
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=89.81  E-value=0.17  Score=34.12  Aligned_cols=23  Identities=35%  Similarity=0.920  Sum_probs=13.0

Q ss_pred             cccccccccccCcCccccccCcccc
Q 037083           65 DHCHKDNEVCSLFGRNSTCCNNKCM   89 (147)
Q Consensus        65 ~~C~~~~~iC~~~~~g~~cC~~~Cv   89 (147)
                      ..|......|..  .+..||++.|.
T Consensus        48 ~~C~~~g~~C~~--~~~~CC~~~C~   70 (75)
T PF02950_consen   48 RRCTPPGSYCCK--RNSECCSGSCN   70 (75)
T ss_dssp             --EB-TTSB-BT--TTTCBSSSCEE
T ss_pred             cccCCCCCcCCC--CCCCCCCCccC
Confidence            467777777822  25679988876


No 4  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=88.96  E-value=0.36  Score=35.38  Aligned_cols=21  Identities=19%  Similarity=0.335  Sum_probs=12.9

Q ss_pred             CchHHHHHHHHHHHHHHHHHhh
Q 037083            1 MNMMKIILTIAITMAITITLTM   22 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~   22 (147)
                      |. -|+|++|+|+||+++.+|+
T Consensus         1 Ma-SK~~llL~l~LA~lLlisS   21 (95)
T PF07172_consen    1 MA-SKAFLLLGLLLAALLLISS   21 (95)
T ss_pred             Cc-hhHHHHHHHHHHHHHHHHh
Confidence            55 4566666666666655554


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=75.45  E-value=3  Score=30.53  Aligned_cols=22  Identities=14%  Similarity=0.240  Sum_probs=14.8

Q ss_pred             chHHHHHHHHHHHHHHHHHhhc
Q 037083            2 NMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         2 ~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      +||-+.++|+++|.|+..+++.
T Consensus         5 ~~llL~l~LA~lLlisSevaa~   26 (95)
T PF07172_consen    5 AFLLLGLLLAALLLISSEVAAR   26 (95)
T ss_pred             HHHHHHHHHHHHHHHHhhhhhH
Confidence            3566777777777777666653


No 6  
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=66.27  E-value=6  Score=27.35  Aligned_cols=23  Identities=13%  Similarity=0.167  Sum_probs=11.4

Q ss_pred             CchHHHHHHHHHHHHHHHHHhhc
Q 037083            1 MNMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      ||-+|-+|+.+++.-.++++|++
T Consensus         1 Mkk~ksifL~l~~~LsA~~FSas   23 (61)
T PF15284_consen    1 MKKFKSIFLALVFILSAAGFSAS   23 (61)
T ss_pred             ChHHHHHHHHHHHHHHHhhhhHH
Confidence            77666555533333344444443


No 7  
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=57.78  E-value=11  Score=30.01  Aligned_cols=21  Identities=19%  Similarity=0.409  Sum_probs=16.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      |++.|.+++++++++|++..+
T Consensus         1 ~~~~kkl~~~~v~~~l~lg~~   21 (170)
T PRK12750          1 MKLAKKLVLAAVVLPLTLGTA   21 (170)
T ss_pred             CchHHHHHHHHHHHHHHHHhh
Confidence            888999988888888887333


No 8  
>PRK13791 lysozyme inhibitor; Provisional
Probab=57.54  E-value=13  Score=28.08  Aligned_cols=21  Identities=24%  Similarity=0.165  Sum_probs=14.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      |+.||++|++.++++|+.-..
T Consensus         1 ~~~mk~~~~~~~~~~ls~~~~   21 (113)
T PRK13791          1 MMKRKLIPFTLFLAALSASTT   21 (113)
T ss_pred             CchHHHHHHHHHHHHHhhhhh
Confidence            788999888776666554333


No 9  
>COG4808 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=56.79  E-value=12  Score=29.96  Aligned_cols=23  Identities=9%  Similarity=0.368  Sum_probs=19.4

Q ss_pred             CchHHHHHHHHHHHHHHHHHhhc
Q 037083            1 MNMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      ||.++.+|.++.+|.++++++.-
T Consensus         1 Mk~l~kl~~~~~alil~~sl~gC   23 (152)
T COG4808           1 MKALNKLFSLVVALVLVFSLAGC   23 (152)
T ss_pred             ChhHHHHHHHHHHHHHHHHhhhc
Confidence            89999998888888888887764


No 10 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=55.22  E-value=11  Score=29.54  Aligned_cols=14  Identities=7%  Similarity=0.408  Sum_probs=7.4

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      |||+.+|++|++++
T Consensus         1 MKll~~lilli~~~   14 (212)
T PF11912_consen    1 MKLLISLILLILLI   14 (212)
T ss_pred             CcHHHHHHHHHHHH
Confidence            77755554444433


No 11 
>PF10880 DUF2673:  Protein of unknown function (DUF2673);  InterPro: IPR024247 This family of proteins with unknown function appears to be restricted to Rickettsiae spp.
Probab=53.28  E-value=13  Score=25.72  Aligned_cols=13  Identities=38%  Similarity=0.792  Sum_probs=7.9

Q ss_pred             Cc-hHHHHHHHHHH
Q 037083            1 MN-MMKIILTIAIT   13 (147)
Q Consensus         1 m~-~~k~~~~l~i~   13 (147)
                      || |+||++||+..
T Consensus         1 mknllkillilafa   14 (65)
T PF10880_consen    1 MKNLLKILLILAFA   14 (65)
T ss_pred             ChhHHHHHHHHHHh
Confidence            55 77777665443


No 12 
>PF06357 Omega-toxin:  Omega-atracotoxin;  InterPro: IPR009415 This family consists of several Hadronyche versuta (Blue mountains funnel-web spider) specific omega-atracotoxin proteins. Omega-Atracotoxin-Hv1a is an insect-specific neurotoxin whose phylogenetic specificity derives from its ability to antagonise insect, but not vertebrate, voltage-gated calcium channels. Two spatially proximal residues, Asn(27) and Arg(35), form a contiguous molecular surface that is essential for toxin activity. It has been proposed that this surface of the beta-hairpin is a key site for interaction of the toxin with insect calcium channels [].; GO: 0019855 calcium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1AXH_A 1HVW_A.
Probab=48.55  E-value=11  Score=23.65  Aligned_cols=17  Identities=29%  Similarity=0.833  Sum_probs=7.2

Q ss_pred             CcCCCCCCccCCceecC
Q 037083          130 NNRCEKGQFCVYGMCDY  146 (147)
Q Consensus       130 g~~C~~g~~C~~G~C~y  146 (147)
                      |..||..+.|+.|.|.|
T Consensus         8 gQPCPyne~CCs~sct~   24 (37)
T PF06357_consen    8 GQPCPYNESCCSGSCTY   24 (37)
T ss_dssp             TSB-SSCCCBSSS-EEE
T ss_pred             CCcCCCCccccccccee
Confidence            34445555555555443


No 13 
>PF05453 Toxin_6:  BmTXKS1/BmP02 toxin family;  InterPro: IPR008911 This family consists of several scorpion toxins which act by blocking small conductance calcium activated potassium ion channels in their victim.; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1ACW_A 1DU9_A 1WM8_A 2KTC_A 1WM7_A.
Probab=46.77  E-value=6.2  Score=23.44  Aligned_cols=24  Identities=29%  Similarity=0.501  Sum_probs=18.6

Q ss_pred             ccccccccccCcCccccccCcccc
Q 037083           66 HCHKDNEVCSLFGRNSTCCNNKCM   89 (147)
Q Consensus        66 ~C~~~~~iC~~~~~g~~cC~~~Cv   89 (147)
                      +|...|.+|..+.+.++|++++|+
T Consensus         2 ~Ce~Cp~hC~~k~ak~~c~n~~C~   25 (28)
T PF05453_consen    2 GCEECPMHCKGKNAKPTCDNGKCN   25 (28)
T ss_dssp             HCSCHHHCCCTTT-EEEEETTEEE
T ss_pred             ccccchhhhcccCCcccccCceee
Confidence            567778888888777889999885


No 14 
>PF05968 Bacillus_PapR:  Bacillus PapR protein;  InterPro: IPR009239 This family consists of the Bacillus species-specific PapR protein. The papR gene belongs to the PlcR regulon and is located 70 bp downstream from plcR. It encodes a 48-amino-acid peptide. Disruption of the papR gene abolishes expression of the PlcR regulon, resulting in a large decrease in haemolysis and virulence in insect larvae. A processed form of PapR activates the PlcR regulon by allowing PlcR to bind to its DNA target. This activating mechanism is strain specific [].
Probab=45.58  E-value=21  Score=23.53  Aligned_cols=21  Identities=29%  Similarity=0.311  Sum_probs=10.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      ||-+-+--+++++|+-.|++.
T Consensus         1 mkkll~~slltlam~~gislg   21 (48)
T PF05968_consen    1 MKKLLIGSLLTLAMAWGISLG   21 (48)
T ss_pred             CchHHHhHHHHHHHHhhhhhh
Confidence            453444445555665555554


No 15 
>PF03823 Neurokinin_B:  Neurokinin B;  InterPro: IPR003635 Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. This family includes neurokinins, as well as many other peptides. Like other tachykinins, neurokinins are synthesized as larger protein precursors that are enzymatically converted to their mature forms.; GO: 0007217 tachykinin receptor signaling pathway
Probab=44.88  E-value=19  Score=24.68  Aligned_cols=27  Identities=19%  Similarity=0.361  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhcCCCcccc
Q 037083            4 MKIILTIAITMAITITLTMKGIGEAEE   30 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~~~~~~~~e~   30 (147)
                      |+..++++.+|||+++-+...+=|+.+
T Consensus         1 MR~~lLf~aiLalsla~s~gavCeesQ   27 (59)
T PF03823_consen    1 MRSTLLFAAILALSLARSFGAVCEESQ   27 (59)
T ss_pred             ChhHHHHHHHHHHHHHHHhhhhhhhhh
Confidence            456667777788888888765544333


No 16 
>PLN02159 Fe(2+) transport protein
Probab=43.45  E-value=19  Score=31.68  Aligned_cols=23  Identities=17%  Similarity=0.473  Sum_probs=17.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHhhc
Q 037083            1 MNMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      |.+||+.||++|+..++.+...+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~   23 (337)
T PLN02159          1 MALMKLVFILLILVSFAVSPATS   23 (337)
T ss_pred             CcHHHHHHHHHHHHHHHcCcccc
Confidence            78999999999887776644443


No 17 
>MTH00042 ND3 NADH dehydrogenase subunit 3; Validated
Probab=43.30  E-value=45  Score=24.77  Aligned_cols=18  Identities=17%  Similarity=0.307  Sum_probs=11.3

Q ss_pred             CchHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITI   18 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~   18 (147)
                      |+.|.+++++++++++.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (116)
T MTH00042          1 MTNLIFFLLIILILTSLL   18 (116)
T ss_pred             ChhHHHHHHHHHHHHHHH
Confidence            777777766666554444


No 18 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=42.52  E-value=39  Score=24.79  Aligned_cols=25  Identities=16%  Similarity=0.449  Sum_probs=14.4

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCCCc
Q 037083            3 MMKIILTIAITMAITITLTMKGIGE   27 (147)
Q Consensus         3 ~~k~~~~l~i~~al~~~~~~~~~~~   27 (147)
                      ||.|+.+|+|++-|.+-+-+++..+
T Consensus        27 lMtILivLVIIiLlImlfqsSS~~~   51 (85)
T PF10717_consen   27 LMTILIVLVIIILLIMLFQSSSNGN   51 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHhccCCCC
Confidence            5666666666665555555544433


No 19 
>MTH00012 ND3 NADH dehydrogenase subunit 3; Validated
Probab=42.35  E-value=50  Score=24.56  Aligned_cols=18  Identities=22%  Similarity=0.447  Sum_probs=11.9

Q ss_pred             CchHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITI   18 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~   18 (147)
                      |++|-+.+++++++++.+
T Consensus         1 ~~~~~~~~~~~~~~~~~l   18 (117)
T MTH00012          1 MSLMMIPMMISLILPPLV   18 (117)
T ss_pred             CcHHHHHHHHHHHHHHHH
Confidence            778887777766554444


No 20 
>PF12798 Fer4_3:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=41.90  E-value=7.9  Score=19.49  Aligned_cols=12  Identities=42%  Similarity=1.165  Sum_probs=7.1

Q ss_pred             cchhcCcCCCCC
Q 037083          125 HCGRCNNRCEKG  136 (147)
Q Consensus       125 nCG~Cg~~C~~g  136 (147)
                      +||.|..+||.+
T Consensus         3 ~C~~C~~~Cp~~   14 (15)
T PF12798_consen    3 GCGACVEVCPTG   14 (15)
T ss_pred             CchHHHHHhcCC
Confidence            456666666654


No 21 
>PF12930 DUF3836:  Family of unknown function (DUF3836);  InterPro: IPR024339 This entry represents a family of bacterial proteins of unknown function.; PDB: 3MSW_A.
Probab=41.51  E-value=9.9  Score=29.30  Aligned_cols=22  Identities=14%  Similarity=0.249  Sum_probs=0.4

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcC
Q 037083            3 MMKIILTIAITMAITITLTMKG   24 (147)
Q Consensus         3 ~~k~~~~l~i~~al~~~~~~~~   24 (147)
                      |||.+++++++++.++..++.+
T Consensus         6 ~~K~~v~~av~~~s~~~~~~~a   27 (132)
T PF12930_consen    6 FMKALVLSAVVAVSVLNTSASA   27 (132)
T ss_dssp             ---------------------T
T ss_pred             HHHHHHHHHHHHHHHHHHHhhC
Confidence            7888888777777766666544


No 22 
>PF08087 Toxin_18:  Conotoxin O-superfamily;  InterPro: IPR012623 This family consists of members of the conotoxin O-superfamily. The O-superfamily of conotoxins consists of 3 groups of Conus peptides that belong to the same structural group. These 3 groups differ in their pharmacological properties: the w-conotoxins which inhibit calcium channels, the delta-conotoxins which slow down the inactivation rate of voltage -sensitive sodium channels and the muO-conotoxins block the voltage sensitive sodium currents [].
Probab=41.35  E-value=12  Score=22.64  Aligned_cols=18  Identities=33%  Similarity=1.095  Sum_probs=14.1

Q ss_pred             ccCCCCCccccCCccccC
Q 037083          102 KKKCKFTEACCRGQCVNL  119 (147)
Q Consensus       102 g~~C~~g~~CC~G~Cvdl  119 (147)
                      |+.|++...||.|.|...
T Consensus         7 GrnC~~~~ecCSGAcSa~   24 (31)
T PF08087_consen    7 GRNCKYSYECCSGACSAA   24 (31)
T ss_pred             CcccccchhhhcccchHH
Confidence            677888888998888543


No 23 
>PHA02706 hypothetical protein; Provisional
Probab=41.04  E-value=30  Score=23.34  Aligned_cols=22  Identities=27%  Similarity=0.368  Sum_probs=16.5

Q ss_pred             CchHHHHHHHHHHHHHHHHHhh
Q 037083            1 MNMMKIILTIAITMAITITLTM   22 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~   22 (147)
                      |+|-..+++|+|+|.|.-..|.
T Consensus         1 mq~e~tllviaiimmllgi~si   22 (58)
T PHA02706          1 MQFENTLLVIAIIMMLLGIASI   22 (58)
T ss_pred             CcchhhhHHHHHHHHHHhhHHH
Confidence            7888888899998877654443


No 24 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=41.00  E-value=19  Score=28.10  Aligned_cols=18  Identities=17%  Similarity=0.600  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 037083            4 MKIILTIAITMAITITLT   21 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~   21 (147)
                      ||+|++|+|++.+.+.+.
T Consensus         1 MKll~~lilli~~~~~~~   18 (212)
T PF11912_consen    1 MKLLISLILLILLIINFS   18 (212)
T ss_pred             CcHHHHHHHHHHHHHhhh
Confidence            899888888876666654


No 25 
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family. Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase. Some species with this reductase lack NapC but accomplish electron transfer to NapAB in some other manner, likely to involve NapH, NapG, and/or some other protein. A few members of this protein are designated MauN and are found in methylamine utilization operons in species that appear to lack a periplasmic nitrate reductase.
Probab=39.67  E-value=13  Score=30.82  Aligned_cols=40  Identities=35%  Similarity=0.651  Sum_probs=25.1

Q ss_pred             CcchhcccCCCCCcc-cc----CCc-cccCccCCCcchhcCcCCCCC
Q 037083           96 KNCGACKKKCKFTEA-CC----RGQ-CVNLSFDKRHCGRCNNRCEKG  136 (147)
Q Consensus        96 ~NCG~Cg~~C~~g~~-CC----~G~-Cvdl~~D~~nCG~Cg~~C~~g  136 (147)
                      .+||.|.++|+.+.. =-    ++. =+ ...+-.+||.|-.+||.+
T Consensus       204 ~~C~~C~~vCP~~~vl~~~~~~~~~~~i-~~~~C~~Cg~Cv~~CP~~  249 (255)
T TIGR02163       204 TNCMDCFNVCPEPQVLRMPLKKGGSTLV-LSGDCTLCGRCIDVCHED  249 (255)
T ss_pred             eEcCCccCcCCCCceeeccccCCCceEe-ccccccchhHHHHhCCcc
Confidence            379999999997641 00    010 11 123455899999999975


No 26 
>TIGR02209 ftsL_broad cell division protein FtsL. This model represents FtsL, both forms similar to that in E. coli and similar to that in B. subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent. The scope of this model is broader than that of the Pfam model pfam04999.3 for FtsL, as this one includes FtsL from Bacillus subtilis and related species.
Probab=39.21  E-value=44  Score=22.61  Aligned_cols=16  Identities=19%  Similarity=0.345  Sum_probs=9.5

Q ss_pred             CchHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAI   16 (147)
Q Consensus         1 m~~~k~~~~l~i~~al   16 (147)
                      ||.+.+++++++++..
T Consensus         1 ~~~l~~~l~~~v~~~~   16 (85)
T TIGR02209         1 EKKLYVLLLLAILVSA   16 (85)
T ss_pred             CchHHHHHHHHHHHHH
Confidence            6766666665555433


No 27 
>PF08105 Antimicrobial10:  Metchnikowin family;  InterPro: IPR012513 This family consists of the metchnikowin family of antimicrobial peptides from Drosophila. metchnikowin is a proline-rich peptide whose expression is immune-inducible. Induction of the metchnikowin gene expression can be mediated either by the TOLL pathway or by the imd gene product. The metchnikowin peptide is unique among the Drosophila antimicrobial peptides in that it is active against both bacteria and fungi [].
Probab=38.94  E-value=42  Score=22.47  Aligned_cols=7  Identities=43%  Similarity=0.415  Sum_probs=4.4

Q ss_pred             CCcchhh
Q 037083           49 RGSRFLA   55 (147)
Q Consensus        49 r~srfLa   55 (147)
                      |+|.|=.
T Consensus        37 RPSPFNP   43 (52)
T PF08105_consen   37 RPSPFNP   43 (52)
T ss_pred             CCCCCCC
Confidence            6777643


No 28 
>PRK09477 napH quinol dehydrogenase membrane component; Provisional
Probab=38.92  E-value=18  Score=30.19  Aligned_cols=41  Identities=27%  Similarity=0.547  Sum_probs=24.7

Q ss_pred             CcchhcccCCCCCcccc---CCc---cccCccCCCcchhcCcCCCCC
Q 037083           96 KNCGACKKKCKFTEACC---RGQ---CVNLSFDKRHCGRCNNRCEKG  136 (147)
Q Consensus        96 ~NCG~Cg~~C~~g~~CC---~G~---Cvdl~~D~~nCG~Cg~~C~~g  136 (147)
                      .+||.|.++|+.+..=-   .+.   =+-...+-.+||.|-.+||.+
T Consensus       211 ~~C~~C~~~CP~~~i~~~~~~~~~~~~~i~~~~C~~Cg~Cv~~CP~~  257 (271)
T PRK09477        211 TRCMDCFHVCPEPQVLRPPLKGKQSPSQVTSGDCITCGRCIDVCSED  257 (271)
T ss_pred             cccCCcCCcCCCcceecccccCCCccceeCcccCcChhHHHhhcCcc
Confidence            37899999998764321   010   000123345799999999975


No 29 
>PF12354 Internalin_N:  Bacterial adhesion/invasion protein N terminal; PDB: 2OMT_A 1H6U_A 3RFS_A 3RFJ_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B ....
Probab=38.48  E-value=13  Score=25.01  Aligned_cols=28  Identities=14%  Similarity=0.234  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCCCcccc
Q 037083            3 MMKIILTIAITMAITITLTMKGIGEAEE   30 (147)
Q Consensus         3 ~~k~~~~l~i~~al~~~~~~~~~~~~e~   30 (147)
                      .+|.++++++++.+++-+..+..++.+.
T Consensus         6 ~lk~~l~~~lv~~i~~~i~~~~~~~v~A   33 (57)
T PF12354_consen    6 WLKNLLILLLVIIISIWIGTSNGTKVQA   33 (57)
T ss_dssp             ----------------------------
T ss_pred             HHHHHHHHHHHHHHHHhhcCCCcceeec
Confidence            5666666666666665444433333333


No 30 
>PF05436 MF_alpha_N:  Mating factor alpha precursor N-terminus;  InterPro: IPR008675 This entry contains the N-terminal regions of the Saccharomyces mating factor alpha precursor protein. All proteins in this family contain one or more copies of IPR006742 from INTERPRO further toward their C terminus.; GO: 0007618 mating, 0005576 extracellular region
Probab=38.38  E-value=34  Score=25.06  Aligned_cols=14  Identities=21%  Similarity=0.342  Sum_probs=8.2

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      |||..+|..++++.
T Consensus         1 MKf~siLsa~ala~   14 (86)
T PF05436_consen    1 MKFSSILSAAALAS   14 (86)
T ss_pred             CchHHHHHHHHHHH
Confidence            77776665544433


No 31 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=38.02  E-value=28  Score=21.68  Aligned_cols=12  Identities=8%  Similarity=0.448  Sum_probs=7.7

Q ss_pred             CchHHHHHHHHH
Q 037083            1 MNMMKIILTIAI   12 (147)
Q Consensus         1 m~~~k~~~~l~i   12 (147)
                      ||.+.+.|++.+
T Consensus         1 Mk~l~~a~~l~l   12 (36)
T PF08194_consen    1 MKCLSLAFALLL   12 (36)
T ss_pred             CceeHHHHHHHH
Confidence            888877555443


No 32 
>PF12071 DUF3551:  Protein of unknown function (DUF3551);  InterPro: IPR021937  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 79 to 104 amino acids in length. This protein has a single completely conserved residue C that may be functionally important. 
Probab=37.83  E-value=42  Score=24.01  Aligned_cols=7  Identities=14%  Similarity=0.358  Sum_probs=3.2

Q ss_pred             ccccccc
Q 037083           66 HCHKDNE   72 (147)
Q Consensus        66 ~C~~~~~   72 (147)
                      .|.-+|+
T Consensus        63 ~C~~NP~   69 (82)
T PF12071_consen   63 YCGINPR   69 (82)
T ss_pred             ccccCcC
Confidence            4444443


No 33 
>smart00289 WR1 Worm-specific repeat type 1. Worm-specific repeat type 1. Cysteine-rich domain apparently unique (so far) to C. elegans. Often appears with KU domains. About 3 dozen worm proteins contain this domain.
Probab=37.29  E-value=29  Score=20.10  Aligned_cols=26  Identities=31%  Similarity=0.735  Sum_probs=19.4

Q ss_pred             cCccCCCcchhcCcCCCCCCccCC---cee
Q 037083          118 NLSFDKRHCGRCNNRCEKGQFCVY---GMC  144 (147)
Q Consensus       118 dl~~D~~nCG~Cg~~C~~g~~C~~---G~C  144 (147)
                      +....+..|-. ...||.|..|.+   ++|
T Consensus         8 ~~~~~~~~C~~-~~~CP~g~~C~~~~~~~C   36 (38)
T smart00289        8 DLGGSPVRCSP-NGSCPSGYSCQNSKQGIC   36 (38)
T ss_pred             cCCCCCeECCC-CCCCCCCCEEecCCCccc
Confidence            45566667777 788998888888   666


No 34 
>TIGR02184 Myco_arth_vir_N Mycoplasma virulence family signal region. This model represents the N-terminal region, including a probable signal sequence or signal anchor which in most instances has four consecutive Lys residues before the hydrophobic stretch, of a family of large, virulence-associated proteins in Mycoplasma arthritidis and smaller proteins in Mycoplasma capricolum.
Probab=37.16  E-value=21  Score=21.90  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHhh
Q 037083            7 ILTIAITMAITITLTM   22 (147)
Q Consensus         7 ~~~l~i~~al~~~~~~   22 (147)
                      |++++++.+++++++.
T Consensus        11 Il~~al~a~l~~S~s~   26 (33)
T TIGR02184        11 IATLVIVTSLLTSLTI   26 (33)
T ss_pred             eehHHHHHHHHHhhee
Confidence            4555666666655554


No 35 
>PRK13728 conjugal transfer protein TrbB; Provisional
Probab=35.93  E-value=26  Score=28.33  Aligned_cols=21  Identities=24%  Similarity=0.531  Sum_probs=17.0

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      ||+.++++++++++++.+..+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~a~   21 (181)
T PRK13728          1 MSLTKLLLVLLLLMATAVQAS   21 (181)
T ss_pred             CchhHHHHHHHHHHhhhhccc
Confidence            899999999888887766544


No 36 
>PF04060 FeS:  Putative Fe-S cluster;  InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster.; GO: 0051536 iron-sulfur cluster binding; PDB: 2YCL_A 4DJF_E 4DJD_C 4DJE_C.
Probab=35.82  E-value=13  Score=22.39  Aligned_cols=10  Identities=50%  Similarity=1.072  Sum_probs=3.8

Q ss_pred             CCcchhcccC
Q 037083           95 DKNCGACKKK  104 (147)
Q Consensus        95 ~~NCG~Cg~~  104 (147)
                      ..|||+||-.
T Consensus         4 ~~nCg~CG~~   13 (35)
T PF04060_consen    4 GTNCGACGYP   13 (35)
T ss_dssp             S----TTSSS
T ss_pred             CCcCCCCCCc
Confidence            3578888754


No 37 
>PF05538 Campylo_MOMP:  Campylobacter major outer membrane protein;  InterPro: IPR008439 Campylobacter are Gram-negative, spiral, microaerophilic bacteria. Campylobacter jejuni is one of the main causative agents of food poisoning in the developed world. This family consists of Campylobacter major outer membrane proteins. The major outer membrane protein (MOMP), a putative porin and a multifunction surface protein of Campylobacter jejuni, may play an important role in the adaptation of the organism to various host environments [].
Probab=35.65  E-value=23  Score=32.62  Aligned_cols=14  Identities=29%  Similarity=0.629  Sum_probs=11.4

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      |||.|+.++-++++
T Consensus         1 MKl~KlSLaAavA~   14 (431)
T PF05538_consen    1 MKLVKLSLAAAVAL   14 (431)
T ss_pred             CchHHHHHHHHHHh
Confidence            99999988866665


No 38 
>PF12869 tRNA_anti-like:  tRNA_anti-like;  InterPro: IPR024422 The function of the proteins in this entry is not known, but they contain a novel variant of the nucleic acid-binding OB fold [].; PDB: 3F1Z_I.
Probab=35.37  E-value=12  Score=27.44  Aligned_cols=21  Identities=24%  Similarity=0.540  Sum_probs=0.0

Q ss_pred             Cc-hHHHHHHHHHHHHHHHHHh
Q 037083            1 MN-MMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~-~~k~~~~l~i~~al~~~~~   21 (147)
                      |+ +.|++++|+++++|++...
T Consensus         1 M~~~kk~l~~~l~~~~la~~~~   22 (144)
T PF12869_consen    1 MKILKKILIIILILIVLAFIIA   22 (144)
T ss_dssp             ----------------------
T ss_pred             CchhhhHHHHHHHHHHHHHHHh
Confidence            77 4555555555544444333


No 39 
>PRK14864 putative biofilm stress and motility protein A; Provisional
Probab=35.04  E-value=41  Score=25.17  Aligned_cols=19  Identities=11%  Similarity=0.258  Sum_probs=13.8

Q ss_pred             CchHHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITIT   19 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~   19 (147)
                      |.+||.++.|+++++|+..
T Consensus         2 ~~~mk~~~~l~~~l~LS~~   20 (104)
T PRK14864          2 NMVMRRFASLLLTLLLSAC   20 (104)
T ss_pred             chHHHHHHHHHHHHHHhhh
Confidence            6678888877777766643


No 40 
>PF15240 Pro-rich:  Proline-rich
Probab=34.80  E-value=31  Score=28.33  Aligned_cols=22  Identities=14%  Similarity=0.161  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhcCC
Q 037083            4 MKIILTIAITMAITITLTMKGI   25 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~~~~~   25 (147)
                      |.+||+.|.+|||+.|=.+...
T Consensus         1 MLlVLLSvALLALSSAQ~~dEd   22 (179)
T PF15240_consen    1 MLLVLLSVALLALSSAQSTDED   22 (179)
T ss_pred             ChhHHHHHHHHHhhhccccccc
Confidence            4566666888889988777543


No 41 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=34.57  E-value=60  Score=21.41  Aligned_cols=17  Identities=29%  Similarity=0.374  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHHHHh
Q 037083            5 KIILTIAITMAITITLT   21 (147)
Q Consensus         5 k~~~~l~i~~al~~~~~   21 (147)
                      |+|.+|+.++++++.++
T Consensus         4 k~i~~i~~~l~~~~~l~   20 (48)
T PRK10081          4 KTIAAIFSVLVLSTVLT   20 (48)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            34444444444444444


No 42 
>PRK12450 foldase protein PrsA; Reviewed
Probab=34.45  E-value=44  Score=28.52  Aligned_cols=23  Identities=30%  Similarity=0.416  Sum_probs=13.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHhhc
Q 037083            1 MNMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      ||-||.++++++++++++.+++-
T Consensus         1 m~~~kk~i~~~~~~~~~~~l~gc   23 (309)
T PRK12450          1 MKQMNKLITGVVTLATVVTLSAC   23 (309)
T ss_pred             CchHHHHHHHHHHHHHHHHHHhc
Confidence            77666665556665555555443


No 43 
>PRK00059 prsA peptidylprolyl isomerase; Provisional
Probab=34.10  E-value=39  Score=28.41  Aligned_cols=22  Identities=9%  Similarity=0.110  Sum_probs=14.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHhh
Q 037083            1 MNMMKIILTIAITMAITITLTM   22 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~   22 (147)
                      |+++|.+++++++.++++++.+
T Consensus         1 ~~~~~~~~~~~~~~~l~~~~~g   22 (336)
T PRK00059          1 MKSIKKLVASLLVGVFIFSAVG   22 (336)
T ss_pred             CchHHHHHHHHHHHHHHHhhcc
Confidence            8888888776666555554443


No 44 
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=33.30  E-value=13  Score=24.35  Aligned_cols=13  Identities=31%  Similarity=0.399  Sum_probs=6.6

Q ss_pred             CchHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMA   15 (147)
Q Consensus         1 m~~~k~~~~l~i~~a   15 (147)
                      ||  ||+|++.++++
T Consensus         1 Mk--Ki~~~~i~~~~   13 (46)
T PF02402_consen    1 MK--KIIFIGIFLLT   13 (46)
T ss_pred             Cc--EEEEeHHHHHH
Confidence            56  55555444444


No 45 
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit. Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species.
Probab=32.26  E-value=31  Score=29.80  Aligned_cols=39  Identities=21%  Similarity=0.467  Sum_probs=24.9

Q ss_pred             CcchhcccCCCCCccccCCc------------cc---------cCccCCCcchhcCcCCCCC
Q 037083           96 KNCGACKKKCKFTEACCRGQ------------CV---------NLSFDKRHCGRCNNRCEKG  136 (147)
Q Consensus        96 ~NCG~Cg~~C~~g~~CC~G~------------Cv---------dl~~D~~nCG~Cg~~C~~g  136 (147)
                      -+||.|-++|+..+.  .+.            =.         +....-..||.|..+||.+
T Consensus         8 i~Cg~C~~~Cp~~~~--~~~~~g~~~~~~~~~~~~l~~~~~~~~~~~~C~~C~~C~~~CP~~   67 (397)
T TIGR03379         8 IKCTVCTVYCPVAKA--NPLYPGPKQAGPDGERLRLKSAELYDEALKYCTNCKRCEVACPSD   67 (397)
T ss_pred             CCCCCCcccCcCccc--cCCccCcccCCcHHHHHhcccchhcccccccCcCcCccchhcCCC
Confidence            379999999997643  100            00         1112234699999999986


No 46 
>PF09716 ETRAMP:  Malarial early transcribed membrane protein (ETRAMP);  InterPro: IPR006389 These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii []. A homologue from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane []. Members have an initial hydrophobic, Phe/Tyr-rich stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region, and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes.
Probab=31.87  E-value=45  Score=23.66  Aligned_cols=19  Identities=26%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             CchHHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITIT   19 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~   19 (147)
                      ||+.|+++++++++++-+-
T Consensus         1 MKi~kv~~ff~~Ll~i~~l   19 (84)
T PF09716_consen    1 MKISKVFYFFAFLLAINLL   19 (84)
T ss_pred             CcHHHHHHHHHHHHHHHhC
Confidence            8999998888888776543


No 47 
>PRK04405 prsA peptidylprolyl isomerase; Provisional
Probab=31.43  E-value=52  Score=28.02  Aligned_cols=22  Identities=23%  Similarity=0.240  Sum_probs=14.3

Q ss_pred             Cc-hHHHHHHHHHHHHHHHHHhh
Q 037083            1 MN-MMKIILTIAITMAITITLTM   22 (147)
Q Consensus         1 m~-~~k~~~~l~i~~al~~~~~~   22 (147)
                      |+ .||.+++++++++++++++.
T Consensus         1 ~~~~~kk~~~~~~~~~~~~~l~g   23 (298)
T PRK04405          1 MKKKMKKWALAAASAGLALSLAG   23 (298)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHh
Confidence            44 77777777777666555554


No 48 
>PF10916 DUF2712:  Protein of unknown function (DUF2712);  InterPro: IPR020208 This entry represents a group of uncharacterised proteins.
Probab=30.68  E-value=67  Score=25.67  Aligned_cols=16  Identities=25%  Similarity=0.310  Sum_probs=8.3

Q ss_pred             hHHHHHHHHHHHHHHH
Q 037083            3 MMKIILTIAITMAITI   18 (147)
Q Consensus         3 ~~k~~~~l~i~~al~~   18 (147)
                      |+|..+-|+|++++.|
T Consensus         4 f~~~~~~~~~a~~~~~   19 (146)
T PF10916_consen    4 FAKKNVRLILAAAIGI   19 (146)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5665555555444444


No 49 
>COG3111 Periplasmic protein with OB-fold [Function unknown]
Probab=30.65  E-value=48  Score=25.97  Aligned_cols=21  Identities=19%  Similarity=0.186  Sum_probs=16.8

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      ||+..+++++++++..++|..
T Consensus         1 mK~~~ia~~~~L~s~~alA~~   21 (128)
T COG3111           1 MKKQAIAALIALVSTPALAAD   21 (128)
T ss_pred             CchHHHHHHHHHhhhHHHhhh
Confidence            888888888888887777665


No 50 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=30.45  E-value=73  Score=20.73  Aligned_cols=19  Identities=32%  Similarity=0.377  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 037083            4 MKIILTIAITMAITITLTM   22 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~~   22 (147)
                      +|.+++++++++.++.+++
T Consensus         3 k~t~l~i~~vll~s~llaa   21 (44)
T COG5510           3 KKTILLIALVLLASTLLAA   21 (44)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            4545555555544444443


No 51 
>PF09065 Haemadin:  Haemadin;  InterPro: IPR015150 Members of this family adopt a secondary structure consisting of five short beta-strands (beta1-beta5), which are arranged in two antiparallel distorted sheets formed by strands beta1-beta4-beta5 and beta2-beta3 facing each other. This beta-sandwich is stabilised by six enclosed cysteines arranged in a [1-2, 3-5, 4-6] disulphide pairing resulting in a disulphide-rich hydrophobic core that is largely inaccessible to bulk solvent. The close proximity of disulphide bonds [3-5] and [4-6] organises haemadin into four distinct loops. The N-terminal segment of this domain binds to the active site of thrombin, inhibiting it []. ; PDB: 1E0F_K.
Probab=30.00  E-value=15  Score=21.34  Aligned_cols=15  Identities=40%  Similarity=0.791  Sum_probs=8.3

Q ss_pred             cCCCCCCccCCceec
Q 037083          131 NRCEKGQFCVYGMCD  145 (147)
Q Consensus       131 ~~C~~g~~C~~G~C~  145 (147)
                      +.|-.||+|..|+|+
T Consensus         6 kiclygqscndgqcs   20 (27)
T PF09065_consen    6 KICLYGQSCNDGQCS   20 (27)
T ss_dssp             SEE-TTEEESSS-EE
T ss_pred             eeeEecccccCCccc
Confidence            456666777777664


No 52 
>PRK13681 hypothetical protein; Provisional
Probab=29.73  E-value=53  Score=20.41  Aligned_cols=14  Identities=21%  Similarity=0.259  Sum_probs=10.7

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      |++.|+.+|.++++
T Consensus         1 M~~~K~~~i~lfal   14 (35)
T PRK13681          1 MRIAKIGVIALFLL   14 (35)
T ss_pred             CcHHHHHHHHHHHH
Confidence            88889888866554


No 53 
>cd00925 Cyt_c_Oxidase_VIa Cytochrome c oxidase subunit VIa.   Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit VIa is expressed in two tissue-specific isoforms in mammals but not fish. VIa-H is the heart and skeletal muscle isoform; VIa-L is the liver or non-muscle isoform.  Mammalian VIa-H induces a slip in CcO (decrease in proton/electron stoichiometry) at high intramitochondrial ATP/ADP ratios, while VIa-L induces a permanent slip i
Probab=29.64  E-value=57  Score=23.71  Aligned_cols=20  Identities=15%  Similarity=0.140  Sum_probs=11.8

Q ss_pred             chHHHHHHHHHHHHHHHHHh
Q 037083            2 NMMKIILTIAITMAITITLT   21 (147)
Q Consensus         2 ~~~k~~~~l~i~~al~~~~~   21 (147)
                      ++-|.|.+++.+.+++++..
T Consensus        14 ~~WkkiS~~va~P~v~l~~~   33 (86)
T cd00925          14 ELWKKISFYVALPAVALCML   33 (86)
T ss_pred             hhhhhhhhhhHHHHHHHHHH
Confidence            45566666666666555444


No 54 
>PF05782 ECM1:  Extracellular matrix protein 1 (ECM1);  InterPro: IPR008605 This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness [].; GO: 0005576 extracellular region
Probab=29.41  E-value=94  Score=29.47  Aligned_cols=23  Identities=13%  Similarity=0.122  Sum_probs=17.9

Q ss_pred             CchHHHHHHHHHHHHHHHHHhhc
Q 037083            1 MNMMKIILTIAITMAITITLTMK   23 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~~   23 (147)
                      |..|..+.+|++.|||+.++|..
T Consensus         1 MGt~srAALvLacLAvaSaASeG   23 (544)
T PF05782_consen    1 MGTMSRAALVLACLAVASAASEG   23 (544)
T ss_pred             CchHHHHHHHHHHHHHHHHhhcC
Confidence            77788888888888888777743


No 55 
>PF00037 Fer4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1DUR_A 1H98_A 1BD6_A 1BQX_A 1BWE_A 1BC6_A 3BK7_A 1FCA_A 1FDN_A 2FDN_A ....
Probab=29.40  E-value=14  Score=20.22  Aligned_cols=12  Identities=42%  Similarity=1.077  Sum_probs=6.8

Q ss_pred             cchhcCcCCCCC
Q 037083          125 HCGRCNNRCEKG  136 (147)
Q Consensus       125 nCG~Cg~~C~~g  136 (147)
                      +||.|-..||.+
T Consensus        10 ~Cg~C~~~CP~~   21 (24)
T PF00037_consen   10 GCGRCVEACPFD   21 (24)
T ss_dssp             S-THHHHHSTTS
T ss_pred             Ccchhhhhcccc
Confidence            566666666654


No 56 
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=29.24  E-value=39  Score=17.69  Aligned_cols=14  Identities=36%  Similarity=1.025  Sum_probs=9.7

Q ss_pred             CCCCCccCCc-eecC
Q 037083          133 CEKGQFCVYG-MCDY  146 (147)
Q Consensus       133 C~~g~~C~~G-~C~y  146 (147)
                      |..|..|.+| .|.|
T Consensus         2 Ck~~~~C~~~~~C~f   16 (19)
T PF14608_consen    2 CKFGPNCTNGDNCPF   16 (19)
T ss_pred             CcCcCCCCCCCcCcc
Confidence            5666667777 7766


No 57 
>PF04706 Dickkopf_N:  Dickkopf N-terminal cysteine-rich region;  InterPro: IPR006796 Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This family represents the N-terminal conserved region []. The C-terminal region has been found to share significant sequence similarity to the colipase fold (IPR001981 from INTERPRO) [].; GO: 0007275 multicellular organismal development, 0030178 negative regulation of Wnt receptor signaling pathway, 0005576 extracellular region
Probab=28.49  E-value=35  Score=22.56  Aligned_cols=31  Identities=29%  Similarity=0.867  Sum_probs=17.5

Q ss_pred             CccccCccCCCcchhcCcCCCCCCccCCceec
Q 037083          114 GQCVNLSFDKRHCGRCNNRCEKGQFCVYGMCD  145 (147)
Q Consensus       114 G~Cvdl~~D~~nCG~Cg~~C~~g~~C~~G~C~  145 (147)
                      +.|..-..-.++|=+ ...|-+|+.|++|+|.
T Consensus        21 ~~C~~Cr~~~~rC~R-d~~CC~g~~CvnG~C~   51 (52)
T PF04706_consen   21 SKCLPCRKRRKRCTR-DAMCCPGNLCVNGVCT   51 (52)
T ss_pred             ccChhhccCCCCCCC-CcccCCCCeeeCCEec
Confidence            344444444444443 4455567788888775


No 58 
>PF07403 DUF1505:  Protein of unknown function (DUF1505);  InterPro: IPR009981 This family consists of several uncharacterised Caenorhabditis elegans proteins of around 115 resides in length. Members of this family contain 6 highly conserved cysteine residues. The function of this family is unknown.
Probab=27.79  E-value=34  Score=26.27  Aligned_cols=16  Identities=13%  Similarity=0.320  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHhhcCC
Q 037083           10 IAITMAITITLTMKGI   25 (147)
Q Consensus        10 l~i~~al~~~~~~~~~   25 (147)
                      .+|++++++|+.+.++
T Consensus         7 ~vl~lsv~vA~~~~~~   22 (114)
T PF07403_consen    7 TVLLLSVTVALASTSP   22 (114)
T ss_pred             hHHHHHHHHHhcCCCc
Confidence            3444444444444333


No 59 
>TIGR01495 ETRAMP Plasmodium ring stage membrane protein ETRAMP. These genes have been shown to be found in the sub-telomeric regions of both P. falciparum and P. yoelii chromosomes.
Probab=27.72  E-value=55  Score=23.59  Aligned_cols=17  Identities=35%  Similarity=0.473  Sum_probs=14.3

Q ss_pred             CchHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAIT   17 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~   17 (147)
                      ||+-|+++.+++++++-
T Consensus         1 MKisKi~~f~~~Ll~in   17 (85)
T TIGR01495         1 MKVSKILYFFAALLAIN   17 (85)
T ss_pred             CchhHHHHHHHHHHHHH
Confidence            89999999888888764


No 60 
>PF05170 AsmA:  AsmA family;  InterPro: IPR007844 The AsmA protein is involved in the assembly of outer membrane proteins in Escherichia coli []. AsmA mutations were isolated as extragenic suppressors of an OmpF assembly mutant []. AsmA may have a role in LPS biogenesis [].
Probab=27.50  E-value=65  Score=29.27  Aligned_cols=18  Identities=28%  Similarity=0.623  Sum_probs=11.0

Q ss_pred             Cc-hHHHHHHHHHHHHHHH
Q 037083            1 MN-MMKIILTIAITMAITI   18 (147)
Q Consensus         1 m~-~~k~~~~l~i~~al~~   18 (147)
                      || ++|+++++++++.+++
T Consensus         1 Mkk~lki~~~~l~~lvll~   19 (604)
T PF05170_consen    1 MKKLLKILLIILAVLVLLV   19 (604)
T ss_pred             CchHHHHHHHHHHHHHHHH
Confidence            77 5777766655554444


No 61 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=27.26  E-value=89  Score=20.48  Aligned_cols=7  Identities=29%  Similarity=0.828  Sum_probs=3.6

Q ss_pred             CCCcccc
Q 037083           32 NLPLEQH   38 (147)
Q Consensus        32 ~~p~~~~   38 (147)
                      ..||+++
T Consensus        38 rDPFeeH   44 (46)
T PRK13183         38 DDPFDDH   44 (46)
T ss_pred             CCchhhc
Confidence            4566443


No 62 
>PF01683 EB:  EB module;  InterPro: IPR006149  The EB domain has no known function. It is found in several Caenorhabditis sp. and Drosophila sp. proteins. The domain contains 8 conserved cysteines that probably form four disulphide bridges and is found associated with kunitz domains IPR002223 from INTERPRO 
Probab=26.95  E-value=78  Score=19.65  Aligned_cols=40  Identities=30%  Similarity=0.710  Sum_probs=23.3

Q ss_pred             CCCCccccCCccccCccCCCcchhcCcCCCCCCccCCceec
Q 037083          105 CKFTEACCRGQCVNLSFDKRHCGRCNNRCEKGQFCVYGMCD  145 (147)
Q Consensus       105 C~~g~~CC~G~Cvdl~~D~~nCG~Cg~~C~~g~~C~~G~C~  145 (147)
                      |..+++--+|+|+....-...|- =+..|..+..|+.|.|.
T Consensus         1 C~~~~~~~~~~C~~~~~~g~~C~-~~~qC~~~s~C~~g~C~   40 (52)
T PF01683_consen    1 CPSGQVAINGQCVPRVQPGESCE-SDEQCIGGSVCVNGRCQ   40 (52)
T ss_pred             CCCCCEEECCEECccCCCCCCCC-CcCCCCCcCEEcCCEeE
Confidence            44455555666666544444443 24556677778887774


No 63 
>TIGR01710 typeII_sec_gspG general secretion pathway protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens.
Probab=26.75  E-value=62  Score=24.20  Aligned_cols=19  Identities=11%  Similarity=0.345  Sum_probs=11.3

Q ss_pred             chHHHHHHHHHHHHHHHHH
Q 037083            2 NMMKIILTIAITMAITITL   20 (147)
Q Consensus         2 ~~~k~~~~l~i~~al~~~~   20 (147)
                      ++|-.++||+|++++++..
T Consensus         7 EllivlaIigil~~i~~p~   25 (134)
T TIGR01710         7 EIMVVLVILGLLAALVAPK   25 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4566666666666655543


No 64 
>PRK04517 hypothetical protein; Provisional
Probab=26.74  E-value=46  Score=27.29  Aligned_cols=14  Identities=14%  Similarity=0.130  Sum_probs=9.7

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      ||+|+.++++++++
T Consensus         1 MK~~~~~~~~~~l~   14 (216)
T PRK04517          1 MKPIKPLTCLLALC   14 (216)
T ss_pred             CCchHHHHHHHHHH
Confidence            89877777655444


No 65 
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional
Probab=26.73  E-value=57  Score=28.00  Aligned_cols=41  Identities=20%  Similarity=0.443  Sum_probs=25.1

Q ss_pred             CcchhcccCCCCCccc---cCCc----------------cccCccCCCcchhcCcCCCCC
Q 037083           96 KNCGACKKKCKFTEAC---CRGQ----------------CVNLSFDKRHCGRCNNRCEKG  136 (147)
Q Consensus        96 ~NCG~Cg~~C~~g~~C---C~G~----------------Cvdl~~D~~nCG~Cg~~C~~g  136 (147)
                      .+||.|-++|+..+.=   -+..                -......=.+||.|...||.+
T Consensus        10 i~Cg~C~~~CP~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~C~~~CP~~   69 (396)
T PRK11168         10 IKCTVCTTACPVARVNPLYPGPKQAGPDGERLRLKDGALYDESLKYCSNCKRCEVACPSG   69 (396)
T ss_pred             CCCCCCCccCCCcccCCCCCChhhhccHHHHHhccchhhcCCCCCcCcCcCccCcccCCC
Confidence            3788888888877420   0001                111223445799999999986


No 66 
>PF10907 DUF2749:  Protein of unknown function (DUF2749);  InterPro: IPR024475 This bacterial family of proteins represent the TrbJ and TrbK genes of the Ti plasmid conjugative transfer operon [].
Probab=26.02  E-value=21  Score=25.02  Aligned_cols=7  Identities=14%  Similarity=0.506  Sum_probs=3.9

Q ss_pred             Ccchhhh
Q 037083           50 GSRFLAE   56 (147)
Q Consensus        50 ~srfLa~   56 (147)
                      +.+|+-.
T Consensus        43 re~ff~~   49 (66)
T PF10907_consen   43 REKFFGG   49 (66)
T ss_pred             HHHHcCC
Confidence            4567653


No 67 
>PRK01904 hypothetical protein; Provisional
Probab=25.96  E-value=68  Score=26.31  Aligned_cols=13  Identities=31%  Similarity=0.411  Sum_probs=8.1

Q ss_pred             CchHHHHHHHHHH
Q 037083            1 MNMMKIILTIAIT   13 (147)
Q Consensus         1 m~~~k~~~~l~i~   13 (147)
                      ||++++++.++++
T Consensus         1 MK~~~~~~~~~~l   13 (219)
T PRK01904          1 MKLRKAALAVATL   13 (219)
T ss_pred             CchhHHHHHHHHH
Confidence            8887766554433


No 68 
>COG3470 Tpd Uncharacterized protein probably involved in high-affinity Fe2+ transport [Inorganic ion transport and metabolism]
Probab=25.89  E-value=76  Score=26.04  Aligned_cols=20  Identities=30%  Similarity=0.408  Sum_probs=14.9

Q ss_pred             CchHHHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITITL   20 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~   20 (147)
                      |+++|+++-.+|++++..+.
T Consensus         1 M~~~k~l~~~~~~a~v~s~~   20 (179)
T COG3470           1 MKMKKLLLSAAILASVFSAP   20 (179)
T ss_pred             CchHHHHHHHHHHHHHHhhh
Confidence            89999998877777665543


No 69 
>PF11777 DUF3316:  Protein of unknown function (DUF3316);  InterPro: IPR016879 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=25.47  E-value=63  Score=23.71  Aligned_cols=10  Identities=30%  Similarity=0.384  Sum_probs=3.7

Q ss_pred             HHHHHHHHHH
Q 037083            5 KIILTIAITM   14 (147)
Q Consensus         5 k~~~~l~i~~   14 (147)
                      |.+++++++|
T Consensus         2 Kk~~ll~~~l   11 (114)
T PF11777_consen    2 KKIILLASLL   11 (114)
T ss_pred             chHHHHHHHH
Confidence            3333333333


No 70 
>MTH00203 ND3 NADH dehydrogenase subunit 3; Provisional
Probab=25.08  E-value=1.3e+02  Score=22.02  Aligned_cols=18  Identities=22%  Similarity=0.617  Sum_probs=10.2

Q ss_pred             CchHHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAITI   18 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~   18 (147)
                      |++|-+.+++++++++.+
T Consensus         1 m~~~~~~~~~~~~~~~~~   18 (112)
T MTH00203          1 MNLIMLFFLIALLLSLIL   18 (112)
T ss_pred             ChHHHHHHHHHHHHHHHH
Confidence            666666666555444443


No 71 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=24.92  E-value=85  Score=18.03  Aligned_cols=13  Identities=38%  Similarity=0.483  Sum_probs=6.2

Q ss_pred             chHHHHHHHHHHH
Q 037083            2 NMMKIILTIAITM   14 (147)
Q Consensus         2 ~~~k~~~~l~i~~   14 (147)
                      ++||.|+++++++
T Consensus         5 ~mmKkil~~l~a~   17 (25)
T PF08139_consen    5 SMMKKILFPLLAL   17 (25)
T ss_pred             HHHHHHHHHHHHH
Confidence            3455555444443


No 72 
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional
Probab=24.73  E-value=29  Score=28.85  Aligned_cols=15  Identities=40%  Similarity=0.866  Sum_probs=11.1

Q ss_pred             ccCCCcchhcccCCC
Q 037083           92 STDDKNCGACKKKCK  106 (147)
Q Consensus        92 ~tD~~NCG~Cg~~C~  106 (147)
                      ..|..|||+||-.|.
T Consensus       147 lp~~lnCg~CG~~C~  161 (229)
T PRK14494        147 LPYNLNCGHCGFNCK  161 (229)
T ss_pred             CCCCCCCCccCcCHH
Confidence            345789999996553


No 73 
>smart00608 ACR ADAM Cysteine-Rich Domain.
Probab=24.68  E-value=45  Score=25.54  Aligned_cols=18  Identities=39%  Similarity=0.887  Sum_probs=16.0

Q ss_pred             ccCCCCCccccCCccccC
Q 037083          102 KKKCKFTEACCRGQCVNL  119 (147)
Q Consensus       102 g~~C~~g~~CC~G~Cvdl  119 (147)
                      |.+|..+.+|-+++||++
T Consensus       120 GT~CG~~kvC~n~~Cv~~  137 (137)
T smart00608      120 GTKCGPGKVCINGQCVDV  137 (137)
T ss_pred             CCCcCCCCccCCCCcccC
Confidence            689999999999999974


No 74 
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family. This subset of the radical-SAM family (pfam04055) includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centered radical. The closest relatives to this family are the pyruvate-formate lyase activating enzyme (PflA, 1.97.1.4, TIGR02493) and the anaerobic ribonucleotide reductase activating enzyme (TIGR02491). Included within this subfamily are activators of hydroxyphenyl acetate decarboxylase (HdpA, ), benzylsuccinate synthase (BssD, ), gycerol dehydratase (DhaB2, ) as well as enzymes annotated in E. coli as activators of different isozymes of pyruvate-formate lyase (PFLC and PFLE) however, these appear to lack characterization and may activate enzymes with distinctive functions. Most of the sequence-level variability between these forms is concentrated within an N-terminal domain which follows a conserved group of three cysteines and contains a variable pattern of 0 
Probab=24.55  E-value=35  Score=28.12  Aligned_cols=39  Identities=31%  Similarity=0.776  Sum_probs=22.9

Q ss_pred             cchhcccCCCCCcccc----CCccccCc---cCCCcchhcCcCCCCC
Q 037083           97 NCGACKKKCKFTEACC----RGQCVNLS---FDKRHCGRCNNRCEKG  136 (147)
Q Consensus        97 NCG~Cg~~C~~g~~CC----~G~Cvdl~---~D~~nCG~Cg~~C~~g  136 (147)
                      +||.|-.+|+.+..=-    .+. ....   ..-..||.|-.+||.+
T Consensus        52 ~C~~C~~~Cp~~a~~~~~~~~~~-~~~~~~~~~C~~Cg~C~~~CP~~   97 (295)
T TIGR02494        52 GCGKCVEVCPAGTARLSELADGR-NRIIIRREKCTHCGKCTEACPSG   97 (295)
T ss_pred             CCchhhhhCcccccccccccCCC-cceeechhhcCchhHhhccCcHh
Confidence            7899999999774210    000 0001   1124688888999865


No 75 
>COG3137 Putative salt-induced outer membrane protein [Cell envelope biogenesis, outer membrane]
Probab=24.45  E-value=55  Score=28.30  Aligned_cols=10  Identities=30%  Similarity=0.378  Sum_probs=7.5

Q ss_pred             CCCCccccch
Q 037083           31 NNLPLEQHTE   40 (147)
Q Consensus        31 ~~~p~~~~~~   40 (147)
                      .+.||++++|
T Consensus        46 ~kspw~gsve   55 (262)
T COG3137          46 AKSPWEGSVE   55 (262)
T ss_pred             cCCccccccc
Confidence            3669988777


No 76 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=24.00  E-value=95  Score=23.16  Aligned_cols=18  Identities=17%  Similarity=0.346  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 037083            4 MKIILTIAITMAITITLT   21 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~   21 (147)
                      +-.||.|++++.+++.++
T Consensus         3 Ll~il~llLll~l~asl~   20 (107)
T PF15330_consen    3 LLGILALLLLLSLAASLL   20 (107)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344555555565655555


No 77 
>PF11337 DUF3139:  Protein of unknown function (DUF3139);  InterPro: IPR021486  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=23.42  E-value=1e+02  Score=21.38  Aligned_cols=15  Identities=47%  Similarity=0.565  Sum_probs=6.4

Q ss_pred             CchHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMA   15 (147)
Q Consensus         1 m~~~k~~~~l~i~~a   15 (147)
                      ||=.|++++++++++
T Consensus         1 MKK~kii~iii~li~   15 (85)
T PF11337_consen    1 MKKKKIILIIIILIV   15 (85)
T ss_pred             CCchHHHHHHHHHHH
Confidence            553344444433333


No 78 
>PF09610 Myco_arth_vir_N:  Mycoplasma virulence signal region (Myco_arth_vir_N);  InterPro: IPR011732 This entry represents the N-terminal region of a family of large, virulence-associated proteins in Mycoplasma arthritidis and smaller proteins in Mycoplasma capricolum. It includes a probable signal sequence or signal anchor, which, in most instances, has four consecutive Lys residues before the hydrophobic stretch.
Probab=23.09  E-value=45  Score=20.47  Aligned_cols=16  Identities=31%  Similarity=0.465  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHhh
Q 037083            7 ILTIAITMAITITLTM   22 (147)
Q Consensus         7 ~~~l~i~~al~~~~~~   22 (147)
                      |++++++.+|+.++++
T Consensus        11 Il~la~~a~l~as~s~   26 (33)
T PF09610_consen   11 ILTLALTASLLASGSF   26 (33)
T ss_pred             hhhHHHHHHHHHceee
Confidence            4455555555555554


No 79 
>PF11137 DUF2909:  Protein of unknown function (DUF2909);  InterPro: IPR021313  This is a family of proteins conserved in Proteobacteria of unknown function. 
Probab=22.98  E-value=1.1e+02  Score=20.89  Aligned_cols=22  Identities=23%  Similarity=0.436  Sum_probs=15.9

Q ss_pred             CchHHHHHHHHHHHHHHHHHhh
Q 037083            1 MNMMKIILTIAITMAITITLTM   22 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~~   22 (147)
                      ||++-++++++|+.+|..++-.
T Consensus         1 ~Ki~iv~lll~ii~sL~saL~~   22 (63)
T PF11137_consen    1 MKILIVLLLLAIIASLFSALFF   22 (63)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHH
Confidence            6777777777777777776665


No 80 
>PF04835 Pox_A9:  A9 protein conserved region;  InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=22.32  E-value=1.5e+02  Score=20.11  Aligned_cols=23  Identities=13%  Similarity=0.351  Sum_probs=16.0

Q ss_pred             hHHHHHHHHHHHHHHHHHhhcCC
Q 037083            3 MMKIILTIAITMAITITLTMKGI   25 (147)
Q Consensus         3 ~~k~~~~l~i~~al~~~~~~~~~   25 (147)
                      .+|+++.++|-|.|.+++..-+.
T Consensus        26 iik~vismimylilGi~L~yis~   48 (54)
T PF04835_consen   26 IIKSVISMIMYLILGIALIYISS   48 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcc
Confidence            46777777777777777766443


No 81 
>PRK11636 mrcA penicillin-binding protein 1a; Provisional
Probab=22.15  E-value=89  Score=30.87  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=12.9

Q ss_pred             CchHHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAIT   17 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~   17 (147)
                      ||++|++|++++.+.++
T Consensus         1 ~~~~~~~~~~~~~~~~~   17 (850)
T PRK11636          1 MKFVKYLLILAVCCILL   17 (850)
T ss_pred             ChHHHHHHHHHHHHHHH
Confidence            89999888877766544


No 82 
>CHL00020 psbN photosystem II protein N
Probab=22.12  E-value=99  Score=20.00  Aligned_cols=7  Identities=43%  Similarity=0.819  Sum_probs=3.6

Q ss_pred             CCCcccc
Q 037083           32 NLPLEQH   38 (147)
Q Consensus        32 ~~p~~~~   38 (147)
                      ..||+++
T Consensus        35 rDPfeeH   41 (43)
T CHL00020         35 RDPFEEH   41 (43)
T ss_pred             CCchhhc
Confidence            4566443


No 83 
>PRK15205 long polar fimbrial protein LpfE; Provisional
Probab=21.85  E-value=77  Score=24.55  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=10.1

Q ss_pred             CchHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITM   14 (147)
Q Consensus         1 m~~~k~~~~l~i~~   14 (147)
                      ||+.|+++.+++++
T Consensus         1 m~~~~~~~~~~~~~   14 (176)
T PRK15205          1 MKNKRALLPLALLL   14 (176)
T ss_pred             CchHHHHHHHHHHh
Confidence            88888777666664


No 84 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=21.81  E-value=1.1e+02  Score=20.50  Aligned_cols=19  Identities=11%  Similarity=0.277  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 037083            4 MKIILTIAITMAITITLTM   22 (147)
Q Consensus         4 ~k~~~~l~i~~al~~~~~~   22 (147)
                      ||++.+|+-++.|++-+-+
T Consensus         1 MRTL~LLaAlLLlAlqaQA   19 (52)
T PF00879_consen    1 MRTLALLAALLLLALQAQA   19 (52)
T ss_pred             CcHHHHHHHHHHHHHHHhc
Confidence            3455555544444544444


No 85 
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=21.22  E-value=40  Score=22.02  Aligned_cols=14  Identities=29%  Similarity=0.629  Sum_probs=9.3

Q ss_pred             ccccCCCcchhccc
Q 037083           90 DLSTDDKNCGACKK  103 (147)
Q Consensus        90 d~~tD~~NCG~Cg~  103 (147)
                      .--.|+..||.||-
T Consensus        33 A~H~dR~~CGKCg~   46 (47)
T PF01599_consen   33 AEHKDRHYCGKCGY   46 (47)
T ss_dssp             EE-SSEEEETTTSS
T ss_pred             eecCCCccCCCccc
Confidence            44568888888873


No 86 
>PF12800 Fer4_4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1BD6_A 1BQX_A 1BWE_A 1BC6_A.
Probab=21.19  E-value=53  Score=16.73  Aligned_cols=9  Identities=44%  Similarity=1.420  Sum_probs=4.9

Q ss_pred             chhcCcCCC
Q 037083          126 CGRCNNRCE  134 (147)
Q Consensus       126 CG~Cg~~C~  134 (147)
                      ||.|-.+||
T Consensus         7 C~~C~~~Cp   15 (17)
T PF12800_consen    7 CGSCVDVCP   15 (17)
T ss_dssp             SSSSTTTST
T ss_pred             CchHHhhcc
Confidence            555555554


No 87 
>PRK09810 entericidin A; Provisional
Probab=21.09  E-value=1e+02  Score=19.56  Aligned_cols=11  Identities=18%  Similarity=0.437  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHH
Q 037083            4 MKIILTIAITM   14 (147)
Q Consensus         4 ~k~~~~l~i~~   14 (147)
                      ||.+++++++.
T Consensus         2 Mkk~~~l~~~~   12 (41)
T PRK09810          2 MKRLIVLVLLA   12 (41)
T ss_pred             hHHHHHHHHHH
Confidence            45555444433


No 88 
>PF12782 Innate_immun:  Invertebrate innate immunity transcript family
Probab=21.00  E-value=33  Score=29.60  Aligned_cols=18  Identities=33%  Similarity=0.501  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 037083            5 KIILTIAITMAITITLTM   22 (147)
Q Consensus         5 k~~~~l~i~~al~~~~~~   22 (147)
                      |+-+|++|+.||+|++.+
T Consensus         4 kvtlivaivaalaisaha   21 (311)
T PF12782_consen    4 KVTLIVAIVAALAISAHA   21 (311)
T ss_pred             eEEehHHHHHHHHHHHhh
Confidence            555677888888877665


No 89 
>PRK15307 major fimbrial protein StkA; Provisional
Probab=20.78  E-value=97  Score=24.71  Aligned_cols=16  Identities=31%  Similarity=0.380  Sum_probs=7.9

Q ss_pred             CchHHHHHHHHHHHHH
Q 037083            1 MNMMKIILTIAITMAI   16 (147)
Q Consensus         1 m~~~k~~~~l~i~~al   16 (147)
                      |++.|+++..++++.|
T Consensus         1 m~~~~~~l~~~~~~~~   16 (201)
T PRK15307          1 MFLKKYGLAAAVAMTL   16 (201)
T ss_pred             CchHHHHHHHHHHHHH
Confidence            7766554443333333


No 90 
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed
Probab=20.77  E-value=1.3e+02  Score=25.25  Aligned_cols=21  Identities=24%  Similarity=0.366  Sum_probs=14.2

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      |+..|.+-.++++++++++++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~   21 (396)
T PRK09474          1 MKIKKGLRTLALSALATLMFS   21 (396)
T ss_pred             CcHHHHHHHHHHHHHHHHHHh
Confidence            777776666666666666665


No 91 
>PF07790 DUF1628:  Protein of unknown function (DUF1628);  InterPro: IPR012859 The sequences making up this family are derived from hypothetical proteins of unknown function expressed by various archaeal species. The region in question is approximately 160 residues long. 
Probab=20.69  E-value=1.3e+02  Score=20.30  Aligned_cols=12  Identities=50%  Similarity=0.639  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHHH
Q 037083            7 ILTIAITMAITI   18 (147)
Q Consensus         7 ~~~l~i~~al~~   18 (147)
                      +++++|++.++.
T Consensus        10 iLliaitVilaa   21 (80)
T PF07790_consen   10 ILLIAITVILAA   21 (80)
T ss_pred             HHHHHHHHHHHH
Confidence            444444444433


No 92 
>PF07835 COX4_pro_2:  Bacterial aa3 type cytochrome c oxidase subunit IV;  InterPro: IPR012422 Bacterial cytochrome c oxidase is found bound to the to the cell membrane, where it is involved in the generation of the transmembrane proton electrochemical gradient. It is composed of four subunits. Subunit IV consists of one transmembrane helix that does not interact directly with the other subunits, but maintains its position by indirect contacts via phospholipid molecules found in the structure. The function of subunit IV is as yet unknown []. ; PDB: 1QLE_D 1M57_J 1M56_J.
Probab=20.53  E-value=1e+02  Score=19.54  Aligned_cols=18  Identities=11%  Similarity=0.052  Sum_probs=8.0

Q ss_pred             chHHHHHHHHHHHHHHHH
Q 037083            2 NMMKIILTIAITMAITIT   19 (147)
Q Consensus         2 ~~~k~~~~l~i~~al~~~   19 (147)
                      ++.|...++++++.+.++
T Consensus        23 ~~~k~~~~~~~~~li~la   40 (44)
T PF07835_consen   23 KLTKWGTIAIAAILIFLA   40 (44)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445554444444433333


No 93 
>PF08116 Toxin_29:  PhTx neurotoxin family;  InterPro: IPR012634 This family consists of PhTx insecticidal neurotoxins that are found in the venom of Phoneutria nigriventer (Brazilian armed spider). The venom of the P. nigrivente contains numerous neurotoxic polypeptides of 30-140 amino acids, which exert a range of biological effects. While some of these neurotoxins are lethal to mice after intracerebroventricular injections, others are extremely toxic to insects of the orders Diptera and Dictyoptera but had much weaker toxic effects on mice [].; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=20.52  E-value=32  Score=20.76  Aligned_cols=14  Identities=36%  Similarity=1.277  Sum_probs=6.4

Q ss_pred             cCCCCCccccCCcc
Q 037083          103 KKCKFTEACCRGQC  116 (147)
Q Consensus       103 ~~C~~g~~CC~G~C  116 (147)
                      ..|.....||.|+|
T Consensus         8 qQCtSDgqCC~G~C   21 (31)
T PF08116_consen    8 QQCTSDGQCCNGRC   21 (31)
T ss_pred             cccCcCCceecchh
Confidence            33444444455544


No 94 
>PF08091 Toxin_21:  Spider insecticidal peptide;  InterPro: IPR012626 This family consists of insecticidal peptides isolated from venom of spiders of Aptostichus schlingeri (Trap-door spider) and Calisoga sp. Nine insecticidal peptides were isolated from the venom of the A. schlinger spider and seven of these toxins cause flaccid paralysis to insect larvae within 10 min of injection. However, all nine peptides were lethal within 24 hours [].; GO: 0009405 pathogenesis, 0005576 extracellular region
Probab=20.41  E-value=43  Score=21.21  Aligned_cols=9  Identities=33%  Similarity=1.121  Sum_probs=4.2

Q ss_pred             cccCccccc
Q 037083           82 TCCNNKCMD   90 (147)
Q Consensus        82 ~cC~~~Cvd   90 (147)
                      .||++.|-+
T Consensus        13 dCC~g~C~~   21 (39)
T PF08091_consen   13 DCCSGNCGY   21 (39)
T ss_pred             hhccCCccc
Confidence            444444444


No 95 
>PHA02291 hypothetical protein
Probab=20.38  E-value=98  Score=24.05  Aligned_cols=21  Identities=14%  Similarity=0.362  Sum_probs=13.5

Q ss_pred             CchHHHHHHHHHHHHHHHHHh
Q 037083            1 MNMMKIILTIAITMAITITLT   21 (147)
Q Consensus         1 m~~~k~~~~l~i~~al~~~~~   21 (147)
                      |.-.+.||-|+++.+|+++++
T Consensus         1 MS~K~~iFYiL~~~VL~~si~   21 (132)
T PHA02291          1 MSRKASIFYILVVIVLAFSIS   21 (132)
T ss_pred             CCcchhhHHHHHHHHHHHHHH
Confidence            555566776666666666665


No 96 
>PRK06273 ferredoxin; Provisional
Probab=20.30  E-value=39  Score=26.73  Aligned_cols=12  Identities=25%  Similarity=0.525  Sum_probs=8.6

Q ss_pred             cchhcCcCCCCC
Q 037083          125 HCGRCNNRCEKG  136 (147)
Q Consensus       125 nCG~Cg~~C~~g  136 (147)
                      .||.|-.+||.+
T Consensus        95 ~Cg~C~~aCP~~  106 (165)
T PRK06273         95 YCLYCHDFCPVF  106 (165)
T ss_pred             CCCCcchhCCHh
Confidence            477777777765


Done!