BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037087
(370 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of
Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp.
Aureus Col
pdb|3R2U|B Chain B, 2.1 Angstrom Resolution Crystal Structure Of
Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp.
Aureus Col
pdb|3R2U|C Chain C, 2.1 Angstrom Resolution Crystal Structure Of
Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp.
Aureus Col
pdb|3R2U|D Chain D, 2.1 Angstrom Resolution Crystal Structure Of
Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp.
Aureus Col
Length = 466
Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
Query: 204 LGGFPMSRHYRF-EGADDVYLNGFCYWVVHRPDYYKEILKFSMTDE 248
LG M H F + DD+Y+ V+H P + E + F +TDE
Sbjct: 110 LGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDE 155
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With
Gtp
pdb|3RAP|S Chain S, The Small G Protein Rap2 In A Non Catalytic Complex With
Gtp
pdb|1KAO|A Chain A, Crystal Structure Of The Small G Protein Rap2a With Gdp
pdb|2RAP|A Chain A, The Small G Protein Rap2a In Complex With Gtp
Length = 167
Score = 28.1 bits (61), Expect = 7.9, Method: Compositional matrix adjust.
Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 7/56 (12%)
Query: 302 SWTKQFTFGPFIETYQPLT--FWRKGEFLLQSSDKRLVLYDST----YEEMRDLGI 351
+ T QF G FIE Y P F+RK E + SS L + D+ + MRDL I
Sbjct: 18 ALTVQFVTGTFIEKYDPTIEDFYRK-EIEVDSSPSVLEILDTAGTEQFASMRDLYI 72
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.141 0.459
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,752,093
Number of Sequences: 62578
Number of extensions: 592992
Number of successful extensions: 1082
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 6
length of query: 370
length of database: 14,973,337
effective HSP length: 100
effective length of query: 270
effective length of database: 8,715,537
effective search space: 2353194990
effective search space used: 2353194990
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)