BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037108
(239 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1BJN|A Chain A, Structure Of Phosphoserine Aminotransferase From
Escherichia Coli
pdb|1BJN|B Chain B, Structure Of Phosphoserine Aminotransferase From
Escherichia Coli
pdb|1BJO|B Chain B, The Structure Of Phosphoserine Aminotransferase From E.
Coli In Complex With Alpha-Methyl-L-Glutamate
Length = 360
Score = 28.5 bits (62), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 17/51 (33%), Positives = 23/51 (45%)
Query: 103 ETDTCVLDLLKPHQSLKKLKINGYGGTKFAIYTLSITGDSLFSRYARMGKW 153
E + DLL + K L +G G +FA L+I GD + Y G W
Sbjct: 50 EAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYW 100
>pdb|1BJO|A Chain A, The Structure Of Phosphoserine Aminotransferase From E.
Coli In Complex With Alpha-Methyl-L-Glutamate
Length = 360
Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 17/51 (33%), Positives = 23/51 (45%)
Query: 103 ETDTCVLDLLKPHQSLKKLKINGYGGTKFAIYTLSITGDSLFSRYARMGKW 153
E + DLL + K L +G G +FA L+I GD + Y G W
Sbjct: 50 EAEKDFRDLLNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYW 100
>pdb|1NEK|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With
Ubiquinone Bound
pdb|1NEN|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With
Dinitrophenol-17 Inhibitor Co-Crystallized At The
Ubiquinone Binding Site
pdb|2ACZ|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With
Atpenin A5 Inhibitor Co-Crystallized At The Ubiquinone
Binding Site
pdb|2WDQ|A Chain A, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Carboxin Bound
pdb|2WDQ|E Chain E, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Carboxin Bound
pdb|2WDQ|I Chain I, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Carboxin Bound
pdb|2WDV|A Chain A, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
Empty Quinone-Binding Pocket
pdb|2WDV|E Chain E, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
Empty Quinone-Binding Pocket
pdb|2WDV|I Chain I, E. Coli Succinate:quinone Oxidoreductase (Sqr) With An
Empty Quinone-Binding Pocket
pdb|2WDR|A Chain A, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Pentachlorophenol Bound
pdb|2WDR|E Chain E, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Pentachlorophenol Bound
pdb|2WDR|I Chain I, E. Coli Succinate:quinone Oxidoreductase (Sqr) With
Pentachlorophenol Bound
pdb|2WP9|A Chain A, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhb His207thr Mutant
pdb|2WP9|E Chain E, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhb His207thr Mutant
pdb|2WP9|I Chain I, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhb His207thr Mutant
pdb|2WS3|A Chain A, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
pdb|2WS3|E Chain E, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
pdb|2WS3|I Chain I, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant
pdb|2WU2|A Chain A, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhc His84met Mutant
pdb|2WU2|E Chain E, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhc His84met Mutant
pdb|2WU2|I Chain I, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhc His84met Mutant
pdb|2WU5|A Chain A, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd His71met Mutant
pdb|2WU5|E Chain E, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd His71met Mutant
pdb|2WU5|I Chain I, Crystal Structure Of The E. Coli Succinate:quinone
Oxidoreductase (Sqr) Sdhd His71met Mutant
Length = 588
Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
Query: 151 GKWIPHGSGKSDEGLADLRELFLVSCSKLQRTLLEYLPSLETL-VIRKCEQLLVSILSLP 209
G W PH K D ++ E L +L RT P E + VI C ++ I +
Sbjct: 305 GPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKV 364
Query: 210 TLRKLTVN 217
T + LTVN
Sbjct: 365 TGQALTVN 372
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.134 0.386
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,906,211
Number of Sequences: 62578
Number of extensions: 267778
Number of successful extensions: 562
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 559
Number of HSP's gapped (non-prelim): 5
length of query: 239
length of database: 14,973,337
effective HSP length: 96
effective length of query: 143
effective length of database: 8,965,849
effective search space: 1282116407
effective search space used: 1282116407
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)