BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037124
(110 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3F3P|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
pdb|3F3P|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
pdb|3F3P|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
pdb|3F3P|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
pdb|3F3P|K Chain K, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
pdb|3F3P|L Chain L, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21212
Length = 570
Score = 25.8 bits (55), Expect = 6.9, Method: Composition-based stats.
Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
Query: 18 FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
F+ Y+ G+F +Y LG+ + + ++ F K+H T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146
>pdb|3F3F|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21
pdb|3F3F|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21
pdb|3F3F|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21
pdb|3F3F|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P21
pdb|3F3G|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P212121
pdb|3F3G|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P212121
pdb|3F3G|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P212121
pdb|3F3G|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
Space Group P212121
Length = 570
Score = 25.8 bits (55), Expect = 6.9, Method: Composition-based stats.
Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
Query: 18 FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
F+ Y+ G+F +Y LG+ + + ++ F K+H T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146
>pdb|3EWE|B Chain B, Crystal Structure Of The Nup85SEH1 COMPLEX
pdb|3EWE|D Chain D, Crystal Structure Of The Nup85SEH1 COMPLEX
Length = 564
Score = 25.8 bits (55), Expect = 6.9, Method: Composition-based stats.
Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
Query: 18 FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
F+ Y+ G+F +Y LG+ + + ++ F K+H T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.335 0.143 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,988,610
Number of Sequences: 62578
Number of extensions: 45898
Number of successful extensions: 89
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 3
length of query: 110
length of database: 14,973,337
effective HSP length: 74
effective length of query: 36
effective length of database: 10,342,565
effective search space: 372332340
effective search space used: 372332340
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 45 (21.9 bits)