BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037124
         (110 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3F3P|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
 pdb|3F3P|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
 pdb|3F3P|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
 pdb|3F3P|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
 pdb|3F3P|K Chain K, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
 pdb|3F3P|L Chain L, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21212
          Length = 570

 Score = 25.8 bits (55), Expect = 6.9,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 18  FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
           F+ Y+ G+F +Y  LG+     +  + ++   F K+H  T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146


>pdb|3F3F|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21
 pdb|3F3F|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21
 pdb|3F3F|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21
 pdb|3F3F|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P21
 pdb|3F3G|C Chain C, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P212121
 pdb|3F3G|D Chain D, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P212121
 pdb|3F3G|G Chain G, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P212121
 pdb|3F3G|H Chain H, Crystal Structure Of The Nucleoporin Pair Nup85-Seh1,
           Space Group P212121
          Length = 570

 Score = 25.8 bits (55), Expect = 6.9,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 18  FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
           F+ Y+ G+F +Y  LG+     +  + ++   F K+H  T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146


>pdb|3EWE|B Chain B, Crystal Structure Of The Nup85SEH1 COMPLEX
 pdb|3EWE|D Chain D, Crystal Structure Of The Nup85SEH1 COMPLEX
          Length = 564

 Score = 25.8 bits (55), Expect = 6.9,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 18  FTLYIEGIFIVYLLLGNA---TIAYLVILTKFFVKKHTCTLTL 57
           F+ Y+ G+F +Y  LG+     +  + ++   F K+H  T+ L
Sbjct: 104 FSAYVSGLFEIYRDLGDDRVFNVPTIGVVNSNFAKEHNATVNL 146


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.335    0.143    0.408 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,988,610
Number of Sequences: 62578
Number of extensions: 45898
Number of successful extensions: 89
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 3
length of query: 110
length of database: 14,973,337
effective HSP length: 74
effective length of query: 36
effective length of database: 10,342,565
effective search space: 372332340
effective search space used: 372332340
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 45 (21.9 bits)