Query         037150
Match_columns 346
No_of_seqs    163 out of 920
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 09:09:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037150.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037150hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 8.7E-30 1.9E-34  216.8   6.8  104    1-107    24-129 (129)
  2 PF00418 Tubulin-binding:  Tau   21.9      46   0.001   22.5   0.9   13  266-278    14-26  (31)
  3 PF05865 Cypo_polyhedrin:  Cypo  14.1 1.8E+02  0.0039   27.1   3.1   27   60-86    141-168 (248)
  4 KOG4286 Dystrophin-like protei  13.0      40 0.00088   37.7  -1.6   56   75-136   612-679 (966)
  5 PF08653 DASH_Dam1:  DASH compl  10.4 1.4E+02   0.003   22.9   1.0   26  289-314     8-33  (58)
  6 PF01473 CW_binding_1:  Putativ   9.6 2.1E+02  0.0045   16.4   1.3    8   32-39      7-14  (19)
  7 COG3100 Uncharacterized protei   8.2 2.2E+02  0.0048   24.1   1.5   14  123-136     9-22  (103)
  8 PRK10154 hypothetical protein;   5.5 6.4E+02   0.014   22.4   2.9   23   79-102    78-100 (134)
  9 PF15102 TMEM154:  TMEM154 prot   5.5 1.9E+02  0.0042   26.0  -0.2   19  125-143    75-93  (146)
 10 PF06645 SPC12:  Microsomal sig   5.1 3.4E+02  0.0073   21.5   1.0   22  319-343    53-74  (76)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=99.96  E-value=8.7e-30  Score=216.76  Aligned_cols=104  Identities=46%  Similarity=0.848  Sum_probs=79.0

Q ss_pred             CCCCCCC-CceeecCCCCCCccchhhHhhhCCCceEEEEeecCccCCCCCCCceeccCCCceeeeecCCceeee-CCeee
Q 037150            1 MNEPLPP-NRIMDVQLYKFSPAQLEVMYKKRREKEMFFFTQRDRKHQNGSRPNRVTGDSSGFWKATSGDKEVKF-NGEII   78 (346)
Q Consensus         1 mG~PLP~-~iI~evDVY~~ePWdLP~~~~~~gd~eWYFFspr~rKy~nG~R~~Ratg~ggGyWKatG~~k~I~~-~g~vI   78 (346)
                      +|.|+|. .+|+++|||++|||+|++. ...++++||||+++.+++.++.|++|++  ++|+||++|+.++|.. ++.+|
T Consensus        24 ~g~~~~~~~~i~~~Diy~~~P~~L~~~-~~~~~~~~yFF~~~~~~~~~~~r~~R~~--~~G~Wk~~g~~~~i~~~~g~~i  100 (129)
T PF02365_consen   24 LGEPLPCEDVIHDVDIYSAHPWELPAK-FKGGDEEWYFFSPRKKKYPNGGRPNRVT--GGGYWKSTGKEKPIKDPGGKVI  100 (129)
T ss_dssp             TT-HHCS-CHSEE--GGGS-GGGCHHH-SSS-SSEEEEEEE----------S-EEE--TTEEEEEECEEEEEEE-TTCEE
T ss_pred             cCCCCCcccceeecccCccChHHhhhh-ccCCCceEEEEEecccccCCcccccccc--cceEEeecccccccccccceee
Confidence            4677888 7999999999999999964 4456789999999999999999999999  9999999999999998 69999


Q ss_pred             EEEEEEeeeeccCCCCCccCeEEEEeeeC
Q 037150           79 GFKKTLAFYKRTSNSTEKTNWIMHEFRAE  107 (346)
Q Consensus        79 G~KKtLvFY~Gr~p~g~KT~WvMhEY~l~  107 (346)
                      |+|++|+||.++.+++.+|+|+||||+|.
T Consensus       101 G~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen  101 GFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             eeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            99999999999888999999999999984


No 2  
>PF00418 Tubulin-binding:  Tau and MAP protein, tubulin-binding repeat;  InterPro: IPR001084 Microtubules consist of tubulins as well as a group of additional proteins collectively known as the Microtubule Associated Proteins (MAP). MAP's have been classified into two classes: high molecular weight MAP's and Tau protein. The Tau proteins promote microtubule assembly and stabilise microtubules. The C-terminal region of these proteins contains three or four tandem repeats of a conserved domain of about thirty amino acid residues which is implicated in tubulin-binding and which seems to have a stiffening effect on microtubules.; GO: 0007026 negative regulation of microtubule depolymerization
Probab=21.93  E-value=46  Score=22.52  Aligned_cols=13  Identities=38%  Similarity=0.677  Sum_probs=11.1

Q ss_pred             ccCCCCccccccc
Q 037150          266 YANASSLDNMHHQ  278 (346)
Q Consensus       266 ~~~~~~~~~~~~~  278 (346)
                      -++|+|||||.|.
T Consensus        14 ~SK~GS~~N~~H~   26 (31)
T PF00418_consen   14 QSKCGSLDNIKHK   26 (31)
T ss_pred             ccccccccccccc
Confidence            3799999999884


No 3  
>PF05865 Cypo_polyhedrin:  Cypovirus polyhedrin protein;  InterPro: IPR008464 This family consists of several Cypovirus polyhedrin proteins. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells [].; PDB: 2OH7_A 2OH5_A 2OH6_A.
Probab=14.08  E-value=1.8e+02  Score=27.10  Aligned_cols=27  Identities=26%  Similarity=0.618  Sum_probs=18.0

Q ss_pred             ceeeeec-CCceeeeCCeeeEEEEEEee
Q 037150           60 GFWKATS-GDKEVKFNGEIIGFKKTLAF   86 (346)
Q Consensus        60 GyWKatG-~~k~I~~~g~vIG~KKtLvF   86 (346)
                      --|.+|| +-|.|..+|++||+...|..
T Consensus       141 hpweatgikyrki~~dgeivgyshyfel  168 (248)
T PF05865_consen  141 HPWEATGIKYRKIHRDGEIVGYSHYFEL  168 (248)
T ss_dssp             -S-B--GGG-EEEEETTEEEEEEEEEE-
T ss_pred             CCccccCceEEEeeccceEeeeeeeeec
Confidence            4599998 66888889999999887754


No 4  
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton]
Probab=13.02  E-value=40  Score=37.69  Aligned_cols=56  Identities=20%  Similarity=0.288  Sum_probs=41.5

Q ss_pred             CeeeEEEE-EEe----------eeeccCCCCCccCeEEEEeeeCCCCCCCCCCCCCCCc-ceEEEEEEEcCCCC
Q 037150           75 GEIIGFKK-TLA----------FYKRTSNSTEKTNWIMHEFRAEDNPPPSKKHGIDMKL-DWVLCRIYHRGSKS  136 (346)
Q Consensus        75 g~vIG~KK-tLv----------FY~Gr~p~g~KT~WvMhEY~l~~~~~~~~~~~~~~~~-d~VLCRIykK~~~~  136 (346)
                      ..|||+|- +|+          |..|++.+|.|++.-|.||.....+...      +++ .-|||--|+.++.-
T Consensus       612 ~pIvG~RyR~l~~fn~dlCq~CF~sgraak~hk~~~pM~Ey~~~tts~~d------~rdfak~L~nkfr~~~~~  679 (966)
T KOG4286|consen  612 CPIIGFRYRSLKHFNYDICQSCFFSGRAAKGHKMHYPMVEYCTPTTSGED------VRDFAKVLKNKFRTKRYF  679 (966)
T ss_pred             CccceeeeeehhhcChhHHhhHhhhcccccCCCCCCCceeeeCCCCChhh------HHHHHHHHHhhhccchhh
Confidence            56788863 344          5679999999999999999998876532      344 55888888866543


No 5  
>PF08653 DASH_Dam1:  DASH complex subunit Dam1;  InterPro: IPR013962  The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis []. In Saccharomyces cerevisiae (Baker's yeast) DASH forms both rings and spiral structures on microtubules in vitro [, ]. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules []. 
Probab=10.38  E-value=1.4e+02  Score=22.88  Aligned_cols=26  Identities=35%  Similarity=0.450  Sum_probs=21.8

Q ss_pred             cccCcchhhhHHHHHHHHHHHhhhcC
Q 037150          289 AQPSNSMIAMDAELQAFAVITESLLS  314 (346)
Q Consensus       289 ~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (346)
                      .+.+.||.+++.+..+.+.|.|+|-.
T Consensus         8 ~eL~D~~~~L~~n~~~L~~ihesL~~   33 (58)
T PF08653_consen    8 AELSDSMETLDKNMEQLNQIHESLSD   33 (58)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34567999999999999999998753


No 6  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=9.55  E-value=2.1e+02  Score=16.44  Aligned_cols=8  Identities=13%  Similarity=0.704  Sum_probs=6.1

Q ss_pred             CceEEEEe
Q 037150           32 EKEMFFFT   39 (346)
Q Consensus        32 d~eWYFFs   39 (346)
                      +..||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            46899994


No 7  
>COG3100 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=8.20  E-value=2.2e+02  Score=24.08  Aligned_cols=14  Identities=36%  Similarity=0.669  Sum_probs=11.4

Q ss_pred             ceEEEEEEEcCCCC
Q 037150          123 DWVLCRIYHRGSKS  136 (346)
Q Consensus       123 d~VLCRIykK~~~~  136 (346)
                      --.||-||+++++.
T Consensus         9 ~~mlCaIYkS~kk~   22 (103)
T COG3100           9 KSMLCAIYKSPKKD   22 (103)
T ss_pred             eeeeeeeeecCcCC
Confidence            45899999998775


No 8  
>PRK10154 hypothetical protein; Provisional
Probab=5.47  E-value=6.4e+02  Score=22.42  Aligned_cols=23  Identities=17%  Similarity=0.333  Sum_probs=16.3

Q ss_pred             EEEEEEeeeeccCCCCCccCeEEE
Q 037150           79 GFKKTLAFYKRTSNSTEKTNWIMH  102 (346)
Q Consensus        79 G~KKtLvFY~Gr~p~g~KT~WvMh  102 (346)
                      |..++|.||..= .++..|+|+--
T Consensus        78 g~s~tl~f~~~l-k~~q~T~W~~~  100 (134)
T PRK10154         78 SASQSLNIPSEI-KEGQTTDWINI  100 (134)
T ss_pred             CCceEEecchhh-ccCCccccEEc
Confidence            445888888643 46889999854


No 9  
>PF15102 TMEM154:  TMEM154 protein family
Probab=5.46  E-value=1.9e+02  Score=26.03  Aligned_cols=19  Identities=21%  Similarity=0.405  Sum_probs=10.9

Q ss_pred             EEEEEEEcCCCCCccccCC
Q 037150          125 VLCRIYHRGSKSKRADQAS  143 (346)
Q Consensus       125 VLCRIykK~~~~kk~~~~~  143 (346)
                      |+|-|++.+|++.|.+..+
T Consensus        75 vV~lv~~~kRkr~K~~~ss   93 (146)
T PF15102_consen   75 VVCLVIYYKRKRTKQEPSS   93 (146)
T ss_pred             HHHheeEEeecccCCCCcc
Confidence            6677776665555544333


No 10 
>PF06645 SPC12:  Microsomal signal peptidase 12 kDa subunit (SPC12);  InterPro: IPR009542  This family consists of several microsomal signal peptidase 12 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 12 kDa subunit (SPC12).; GO: 0008233 peptidase activity, 0006465 signal peptide processing, 0005787 signal peptidase complex, 0016021 integral to membrane
Probab=5.12  E-value=3.4e+02  Score=21.49  Aligned_cols=22  Identities=36%  Similarity=0.877  Sum_probs=17.8

Q ss_pred             CcccccccccccCCCCCCCCccccc
Q 037150          319 ASVYPFKSSYARNDPLWMPTLPEFQ  343 (346)
Q Consensus       319 ~~~~~~~~~~~~~~~~~~~~~~~~~  343 (346)
                      .-+||+   |.||...|.+..++-+
T Consensus        53 vP~Wp~---y~r~p~~W~~~~~~~~   74 (76)
T PF06645_consen   53 VPPWPF---YNRHPLKWLPPKPEKE   74 (76)
T ss_pred             eCCcHh---hcCCcccCCCCCcccc
Confidence            347998   8899999999887644


Done!