Citrus Sinensis ID: 037197


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------101
MQTHLLFLYCYIVESNADDELSTLLSIKAGLIDPLNMLEDWKMPSNAAENGLLHCNWTGVWCNSRGFVEKLDLSNMSLNGSVSENIRGLRSLSSLNICCNEFASSLPKSLANLTALKSMDVSQNNFIGSFPTGLGKASGLTSVNASSNNFSGFLPEDLGNATSLESLDFRGSFFEGSVPTSFRNLQKLKFLGLSGNNLTGKIPPELGQLSSLETIILGYNAFEGEIPAEFGNLTNLRYLDLAVGSLSGQIPPALGRLKKLTTVYLYKNNFTGKIPPELGSITSLAFLDLSDNQISGEIPVKLAELKNLQLLNLMCNQLTGLIPDKLGELTKLEVLELWKNSLIGSLPMRLGQSSPLRRLDASSNLLSGEIPTGLCDSGNLTKLILFNNSFSGTFPVSLSTCKSLVRVRVQNNLISGTIPVGLGNLPSLQRLEMANNNLTGQIPDDISLSTSLSFVDISWNHLESYLPSSILSIPSLQTFMASHNNLQAKIPNELQACPSLSVLDLSSNSLSGEIPASIASCEKLVSLNLRNNRFSGEIPKAVATMPTLAILDMSNNSLFGRIPENFGASPALEMLNLSYNKLEGPVPSNGILMNINPNELIGNAGLCGSVLPPCSQNLTAKPGQTRKMHINHIIFGFIIGTLVIVSLGIVFFAGKWAYRRWYLYNSFFDDLFKKSCKEWPWRLIAFQRLNFTSSEILACVKESNIIGMGGNGIVYKAEFHRPHMVVAVKKLWRSDNDIESGDDLFREVSLLGRLRHRNIVRLLGYLHNETNVMMVYDYMPNDSLGEALHGKEAGKLLVDWVSRYNIAVGIAQGLNYLHHDCQPPVIHRDIKSNNILLDANLEARIADFGLARMMLHKNETVSMVAGSYGYIAPEYGYTLKVDEKSDIYSFGVVLLELLTGKMPLDPAFGGSKDIVEWVLSMIKSNKAQDEALDPSIAGQCKHVQEEMLLVLRIAVLCTAKLPKGRPTMRDVITMLGEAKPRRKSICQNGGHNLSKERPIFGNSPVLGLL
cHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccCEEEEccccccEEEEEccccccCECccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEcccccccccccHHHHcccccccEEccccccECccccccccccccccccccccccEEcccccccccccccEEEccccCEEEccccccccccccccccccccEEEECccHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccHHHHcccccccEEccccEEECcccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccHHHHHHccccccEEEcccccEEEEEECccccEEEEEEEECcccccccccccHHHHHHHHccccccccccEEEEEEcccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccCCcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccc
MQTHLLFLYCYIVESNADDELSTLLSIKAGLIDPLNMLEDWKMPSNAAENGLLHCNWTGVWCNSRGFVEKLDLSNMSLNGSVSENIRGLRSLSSLNICCNEFASSLPKSLANLTALKSMDVSQNNFIGSFPTGLGKASGLTSVNASSNNFSGFLPEDLGNATSLESLDFRGSFFEGSVPTSFRNLQKLKFLGLSGNNLTGKIPPELGQLSSLETIILGYNAFEGEIPAEFGNLTNLRYLDLAVGSLSGQIPPALGRLKKLTTVYLYKNNFTGKIPPELGSITSLAFLDLSDNQISGEIPVKLAELKNLQLLNLMCNQLTGLIPDKLGELTKLEVLELWKNSLIGSLPMRLGQSSPLRRLDASSNLLSGEIPTGLCDSGNLTKLILFNNSFSGTFPVSLSTCKSLVRVRVQNNLISGTIPVGLGNLPSLQRLEMANNNLTGQIPDDISLSTSLSFVDISWNHLESYLPSSILSIPSLQTFMASHNNLQAKIPNELQACPSLSVLDLSSNSLSGEIPASIASCEKLVSLNLRNNRFSGEIPKAVATMPTLAILDMSNNSLFGRIPENFGASPALEMLNLSYNKLEGPVPSNGILMNINPNELIGNAGLCGSVLP***************MHINHIIFGFIIGTLVIVSLGIVFFAGKWAYRRWYLY************KEWPWRLIAFQRLNFTSSEILACVKESNIIGMGGNGIVYKAEFHRPHMVVAVKKLWRSDNDIESGDDLFREVSLLGRLRHRNIVRLLGYLHNETNVMMVYDYMPNDSLGEALHGKEAGKLLVDWVSRYNIAVGIAQGLNYLHHDCQPPVIHRDIKSNNILLDANLEARIADFGLARMMLHKNETVSMVAGSYGYIAPEYGYTLKVDEKSDIYSFGVVLLELLTGKMPLDPAFGGSKDIVEWVLSMIKSNKAQDEALDPSIAGQCKHVQEEMLLVLRIAVLCTAKLPKGRPTMRDVITMLG**************************SPVLGLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTHLLFLYCYIVESNADDELSTLLSIKAGLIDPLNMLEDWKMPSNAAENGLLHCNWTGVWCNSRGFVEKLDLSNMSLNGSVSENIRGLRSLSSLNICCNEFASSLPKSLANLTALKSMDVSQNNFIGSFPTGLGKASGLTSVNASSNNFSGFLPEDLGNATSLESLDFRGSFFEGSVPTSFRNLQKLKFLGLSGNNLTGKIPPELGQLSSLETIILGYNAFEGEIPAEFGNLTNLRYLDLAVGSLSGQIPPALGRLKKLTTVYLYKNNFTGKIPPELGSITSLAFLDLSDNQISGEIPVKLAELKNLQLLNLMCNQLTGLIPDKLGELTKLEVLELWKNSLIGSLPMRLGQSSPLRRLDASSNLLSGEIPTGLCDSGNLTKLILFNNSFSGTFPVSLSTCKSLVRVRVQNNLISGTIPVGLGNLPSLQRLEMANNNLTGQIPDDISLSTSLSFVDISWNHLESYLPSSILSIPSLQTFMASHNNLQAKIPNELQACPSLSVLDLSSNSLSGEIPASIASCEKLVSLNLRNNRFSGEIPKAVATMPTLAILDMSNNSLFGRIPENFGASPALEMLNLSYNKLEGPVPSNGILMNINPNELIGNAGLCGSVLPPCSQNLTAKPGQTRKMHINHIIFGFIIGTLVIVSLGIVFFAGKWAYRRWYLYNSFFDDLFKKSCKEWPWRLIAFQRLNFTSSEILACVKESNIIGMGGNGIVYKAEFHRPHMVVAVKKLWRSDNDIESGDDLFREVSLLGRLRHRNIVRLLGYLHNETNVMMVYDYMPNDSLGEALHGKEAGKLLVDWVSRYNIAVGIAQGLNYLHHDCQPPVIHRDIKSNNILLDANLEARIADFGLARMMLHKNETVSMVAGSYGYIAPEYGYTLKVDEKSDIYSFGVVLLELLTGKMPLDPAFGGSKDIVEWVLSMIKSNKAQDEALDPSIAGQCKHVQEEMLLVLRIAVLCTAKLPKGRPTMRDVITMLGEAKPRRKSICQNGGHNLSKERPIFGNSPVLGLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat receptor-like protein kinase PXL1 Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.probableQ9FRS6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 402-463,488-580
View the alignment between query and template
View the model in PyMOL
Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 374-532
View the alignment between query and template
View the model in PyMOL
Template: 1XEU, chain A
Confidence level:very confident
Coverage over the Query: 280-465
View the alignment between query and template
View the model in PyMOL
Template: 1XEU, chain A
Confidence level:very confident
Coverage over the Query: 158-295
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 15-618
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 694-984
View the alignment between query and template
View the model in PyMOL
Template: 3PSC, chain A
Confidence level:probable
Coverage over the Query: 704-904,923-929,941-1000
View the alignment between query and template
View the model in PyMOL
Template: 3H9R, chain A
Confidence level:probable
Coverage over the Query: 665-915
View the alignment between query and template
View the model in PyMOL