BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037219
         (109 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1KHB|A Chain A, Pepck Complex With Nonhydrolyzable Gtp Analog, Native Data
 pdb|1KHF|A Chain A, Pepck Complex With Pep
 pdb|1KHG|A Chain A, Pepck
 pdb|1M51|A Chain A, Pepck Complex With A Gtp-Competitive Inhibitor
 pdb|1NHX|A Chain A, Pepck Complex With A Gtp-Competitive Inhibitor
 pdb|2GMV|A Chain A, Pepck Complex With A Gtp-Competitive Inhibitor
 pdb|2GMV|B Chain B, Pepck Complex With A Gtp-Competitive Inhibitor
          Length = 625

 Score = 25.8 bits (55), Expect = 6.2,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 9   HHGLELGAKKENFPTATAEKVKTGLVYVVMAV----GFKFRVCCLKWLALAEHIVAYL 62
            HG+ +GA   +  TA AE     +++   A+    G+ F      WL++A+H  A L
Sbjct: 454 QHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKL 511


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,290,261
Number of Sequences: 62578
Number of extensions: 114039
Number of successful extensions: 213
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 213
Number of HSP's gapped (non-prelim): 1
length of query: 109
length of database: 14,973,337
effective HSP length: 73
effective length of query: 36
effective length of database: 10,405,143
effective search space: 374585148
effective search space used: 374585148
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)