BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037219
(109 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans
GN=laat-1 PE=1 SV=2
Length = 311
Score = 28.9 bits (63), Expect = 9.7, Method: Compositional matrix adjust.
Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
Query: 19 ENFPTATAEKVKTGLVYVVMAVGFKFRVCCL----KWLALAEHIVAYLGSHGVC 68
+N+ ++ E + + Y+++A F + + L WL L H+ GS G C
Sbjct: 222 KNYRHSSCEGLSLTMFYIIVAANFTYGISVLLATTSWLYLLRHLPWLAGSLGCC 275
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.137 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,966,906
Number of Sequences: 539616
Number of extensions: 1433588
Number of successful extensions: 2582
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2582
Number of HSP's gapped (non-prelim): 1
length of query: 109
length of database: 191,569,459
effective HSP length: 77
effective length of query: 32
effective length of database: 150,019,027
effective search space: 4800608864
effective search space used: 4800608864
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)