BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037219
         (109 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q95XZ6|LAAT1_CAEEL Lysosomal amino acid transporter 1 OS=Caenorhabditis elegans
           GN=laat-1 PE=1 SV=2
          Length = 311

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 19  ENFPTATAEKVKTGLVYVVMAVGFKFRVCCL----KWLALAEHIVAYLGSHGVC 68
           +N+  ++ E +   + Y+++A  F + +  L     WL L  H+    GS G C
Sbjct: 222 KNYRHSSCEGLSLTMFYIIVAANFTYGISVLLATTSWLYLLRHLPWLAGSLGCC 275


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.137    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,966,906
Number of Sequences: 539616
Number of extensions: 1433588
Number of successful extensions: 2582
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2582
Number of HSP's gapped (non-prelim): 1
length of query: 109
length of database: 191,569,459
effective HSP length: 77
effective length of query: 32
effective length of database: 150,019,027
effective search space: 4800608864
effective search space used: 4800608864
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)