Query         037219
Match_columns 109
No_of_seqs    24 out of 26
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:57:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/037219.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/037219hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG3380 Predicted NAD/FAD-depe  90.9   0.089 1.9E-06   44.8   0.7   16   47-62    303-331 (331)
  2 KOG2730 Methylase [General fun  87.2    0.42 9.1E-06   39.7   2.1   32   41-72    140-180 (263)
  3 PHA02774 E1; Provisional        76.5     2.3 5.1E-05   38.8   2.9   41   25-65    162-221 (613)
  4 PF04876 Tenui_NCP:  Tenuivirus  62.7     6.5 0.00014   31.1   2.3   27   47-73    112-155 (175)
  5 TIGR00562 proto_IX_ox protopor  59.0      15 0.00032   29.6   3.9   20   24-43    370-390 (462)
  6 PF06883 RNA_pol_Rpa2_4:  RNA p  54.9     4.9 0.00011   26.0   0.4   37   53-95      7-48  (58)
  7 COG4321 Uncharacterized protei  54.4     5.9 0.00013   29.0   0.8   11   45-55     72-82  (102)
  8 PF08933 DUF1864:  Domain of un  52.3      13 0.00027   32.7   2.6   73   25-99    148-243 (387)
  9 TIGR02435 CobG precorrin-3B sy  45.0      28 0.00061   28.8   3.5   26   53-78    109-137 (390)
 10 PF11294 DUF3095:  Protein of u  44.9      47   0.001   28.8   4.8   66   20-85     81-184 (373)
 11 PLN02576 protoporphyrinogen ox  43.7      20 0.00042   29.5   2.3   18   47-64    459-489 (496)
 12 COG0172 SerS Seryl-tRNA synthe  41.7      20 0.00044   31.4   2.3   24   23-46    294-321 (429)
 13 cd08782 Death_DAPK1 Death doma  41.0      15 0.00032   24.9   1.1   17   48-64     17-39  (82)
 14 cd07397 MPP_DevT Myxococcus xa  40.2      14 0.00031   29.6   1.0   15   47-61    167-191 (238)
 15 PF15295 CCDC50_N:  Coiled-coil  39.9      20 0.00044   27.1   1.7   13   47-59     17-34  (132)
 16 TIGR03124 ctirate_citX holo-AC  35.1      28  0.0006   26.6   1.8   15   25-39     88-102 (165)
 17 PF11390 FdsD:  NADH-dependant   34.9      25 0.00054   23.1   1.4   13   53-65      4-16  (61)
 18 PRK09190 hypothetical protein;  32.9      56  0.0012   26.0   3.3   43    7-50     70-116 (220)
 19 PF01964 ThiC:  ThiC family;  I  31.2      56  0.0012   29.0   3.3   23   17-39    326-348 (420)
 20 PF01841 Transglut_core:  Trans  29.2      32  0.0007   22.1   1.2   20   32-51     59-79  (113)
 21 smart00460 TGc Transglutaminas  28.4      37 0.00081   20.1   1.3   15   36-50     19-33  (68)
 22 COG3565 Predicted dioxygenase   26.0      45 0.00097   25.6   1.6   13   48-60     79-91  (138)
 23 PF15463 ECM11:  Extracellular   25.5      55  0.0012   23.8   1.9    6   47-52     76-81  (139)
 24 PF03802 CitX:  Apo-citrate lya  23.7      57  0.0012   24.7   1.8   15   25-39     90-104 (170)
 25 PF06200 tify:  tify domain;  I  23.4      67  0.0015   19.2   1.7   13   19-31     20-32  (36)
 26 COG2221 DsrA Dissimilatory sul  21.9 1.2E+02  0.0027   25.8   3.6   54   20-78     74-146 (317)
 27 PF10686 DUF2493:  Protein of u  21.8      32  0.0007   22.6   0.1   17    8-24     50-66  (71)
 28 cd08312 Death_MyD88 Death doma  21.6      49  0.0011   21.9   1.0   12   47-58     15-26  (79)
 29 KOG3259 Peptidyl-prolyl cis-tr  21.4      92   0.002   24.5   2.6   55   53-107    87-141 (163)
 30 TIGR01658 EYA-cons_domain eyes  20.8      66  0.0014   27.2   1.8   69   10-95    196-270 (274)

No 1  
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]
Probab=90.90  E-value=0.089  Score=44.77  Aligned_cols=16  Identities=44%  Similarity=0.804  Sum_probs=14.1

Q ss_pred             hhhhHH-------------HHHHHHHHHh
Q 037219           47 CCLKWL-------------ALAEHIVAYL   62 (109)
Q Consensus        47 iCGDWl-------------ALA~~Ia~y~   62 (109)
                      +|||||             |+|+||..++
T Consensus       303 ~cGDwc~GgrVEgA~LSGlAaA~~i~~~L  331 (331)
T COG3380         303 ACGDWCAGGRVEGAVLSGLAAADHILNGL  331 (331)
T ss_pred             eecccccCcchhHHHhccHHHHHHHHhcC
Confidence            999999             8999998753


No 2  
>KOG2730 consensus Methylase [General function prediction only]
Probab=87.24  E-value=0.42  Score=39.70  Aligned_cols=32  Identities=25%  Similarity=0.302  Sum_probs=20.4

Q ss_pred             cccchh--hhhhHHHHHHHHHHH-------hccCCCCchhh
Q 037219           41 GFKFRV--CCLKWLALAEHIVAY-------LGSHGVCSEEF   72 (109)
Q Consensus        41 gl~tRv--iCGDWlALA~~Ia~y-------~~s~~~~~eef   72 (109)
                      |++.||  ||||||-|+-.+..-       |.|+++..+..
T Consensus       140 GI~~rItFI~GD~ld~~~~lq~~K~~~~~vf~sppwggp~y  180 (263)
T KOG2730|consen  140 GVPDRITFICGDFLDLASKLKADKIKYDCVFLSPPWGGPSY  180 (263)
T ss_pred             cCCceeEEEechHHHHHHHHhhhhheeeeeecCCCCCCcch
Confidence            455577  999999777665432       55665555443


No 3  
>PHA02774 E1; Provisional
Probab=76.53  E-value=2.3  Score=38.81  Aligned_cols=41  Identities=27%  Similarity=0.493  Sum_probs=33.0

Q ss_pred             hHHHHHHHHHH-HHHHhccc----chh------hhhhHH--------HHHHHHHHHhccC
Q 037219           25 TAEKVKTGLVY-VVMAVGFK----FRV------CCLKWL--------ALAEHIVAYLGSH   65 (109)
Q Consensus        25 ~AekV~~~Ml~-ve~ALgl~----tRv------iCGDWl--------ALA~~Ia~y~~s~   65 (109)
                      ++...++.||+ |+.+.|++    ||.      +|.||+        .|++.+...++.+
T Consensus       162 ~~~n~~a~~l~kFKe~fgvsf~eLtR~FKSdKTcc~dWVv~v~gv~~~~~ea~k~lLq~~  221 (613)
T PHA02774        162 RSSNRRATLLAKFKEAFGVSFTELTRPFKSDKTCCNDWVVAVFGVSEELLEASKTLLQQH  221 (613)
T ss_pred             hcchHHHHHHHHHHHHhcccHHHheecccCCCccchhheEEEEecCHHHHHHHHHHHHhh
Confidence            56678899999 99999998    665      999999        7777777766544


No 4  
>PF04876 Tenui_NCP:  Tenuivirus major non-capsid protein;  InterPro: IPR006960 This entry contains the tenuivirus major non-capsid protein. Proteins accumulate in large amounts in tenuivirus infected cells. They are found in the inclusion bodies that are formed after infection [].
Probab=62.70  E-value=6.5  Score=31.08  Aligned_cols=27  Identities=19%  Similarity=0.425  Sum_probs=22.7

Q ss_pred             hhhhHH-----------------HHHHHHHHHhccCCCCchhhh
Q 037219           47 CCLKWL-----------------ALAEHIVAYLGSHGVCSEEFD   73 (109)
Q Consensus        47 iCGDWl-----------------ALA~~Ia~y~~s~~~~~eefa   73 (109)
                      -||||.                 .|-+.|-+.+.+-+.+.|+..
T Consensus       112 ~lGdWIT~~~Lkh~n~MSk~Qik~L~~~Ii~~akae~~dtE~Ye  155 (175)
T PF04876_consen  112 KLGDWITKNFLKHPNRMSKDQIKTLCEQIIEMAKAESSDTEHYE  155 (175)
T ss_pred             HhhhHHHHHHHhccchhhHHHHHHHHHHHHHHHhccCCchHHHH
Confidence            799999                 899999999988777777654


No 5  
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase. This protein is a flavoprotein and has a beta-alpha-beta dinucleotide binding motif near the amino end.
Probab=58.98  E-value=15  Score=29.57  Aligned_cols=20  Identities=0%  Similarity=0.069  Sum_probs=13.4

Q ss_pred             hhHHHHHHHHHH-HHHHhccc
Q 037219           24 ATAEKVKTGLVY-VVMAVGFK   43 (109)
Q Consensus        24 ~~AekV~~~Ml~-ve~ALgl~   43 (109)
                      ...+++.+.+++ +...+|++
T Consensus       370 ~~~ee~~~~v~~~L~~~~gi~  390 (462)
T TIGR00562       370 LSENEIINIVLRDLKKVLNIN  390 (462)
T ss_pred             CCHHHHHHHHHHHHHHHhCCC
Confidence            345677777777 77777655


No 6  
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=54.86  E-value=4.9  Score=26.04  Aligned_cols=37  Identities=27%  Similarity=0.348  Sum_probs=20.4

Q ss_pred             HHHHHHHHHhccCCC-----CchhhhcccCCcccCCCcCCCCCCCCCC
Q 037219           53 ALAEHIVAYLGSHGV-----CSEEFDVGLQTNILPLKGHDIGQFLGLE   95 (109)
Q Consensus        53 ALA~~Ia~y~~s~~~-----~~eefa~GL~~~~~p~~G~dIGqFPG~~   95 (109)
                      ..|.+|++.++.--.     -|....|    .|.|..  --|||||+-
T Consensus         7 ~~a~~~~~~LR~~Kv~~~~~vP~~lEI----~~VP~~--~~g~yPGLy   48 (58)
T PF06883_consen    7 EEAEQIADQLRYLKVEGEHGVPPTLEI----GYVPPS--KGGQYPGLY   48 (58)
T ss_pred             HHHHHHHHHHHHHHHcCCCCCCCceEE----EEEECC--CCCCCCeEE
Confidence            566777776643322     2222233    455555  339999974


No 7  
>COG4321 Uncharacterized protein related to arylsulfate sulfotransferase involved in siderophore biosynthesis [General function prediction only]
Probab=54.44  E-value=5.9  Score=29.04  Aligned_cols=11  Identities=73%  Similarity=1.784  Sum_probs=9.5

Q ss_pred             hhhhhhHHHHH
Q 037219           45 RVCCLKWLALA   55 (109)
Q Consensus        45 RviCGDWlALA   55 (109)
                      ||+|++||++-
T Consensus        72 RV~clr~L~~~   82 (102)
T COG4321          72 RVCCLRWLKLR   82 (102)
T ss_pred             HHHHHHHHHHh
Confidence            99999999653


No 8  
>PF08933 DUF1864:  Domain of unknown function (DUF1864);  InterPro: IPR015029 This protein has no known function. It is found in various hypothetical and conserved domain proteins. ; PDB: 2NWB_A 1ZEE_B 2X66_A 2V7L_A 2V7M_A 2V7K_A 2X67_A 2X68_A 2V7J_A 2V7I_A.
Probab=52.30  E-value=13  Score=32.66  Aligned_cols=73  Identities=15%  Similarity=0.195  Sum_probs=48.0

Q ss_pred             hHHHHHHHHHHHHHHhccc--------chhhhhhHH-H-------HHHHHHHHhccCCCCchhhhcccCCcccCCC----
Q 037219           25 TAEKVKTGLVYVVMAVGFK--------FRVCCLKWL-A-------LAEHIVAYLGSHGVCSEEFDVGLQTNILPLK----   84 (109)
Q Consensus        25 ~AekV~~~Ml~ve~ALgl~--------tRviCGDWl-A-------LA~~Ia~y~~s~~~~~eefa~GL~~~~~p~~----   84 (109)
                      .-+-|+..|++++.|+-.-        +-.+++|=| +       +-+.|...|  ...+|+.|.--+..=|+|..    
T Consensus       148 flD~nt~~ila~~~Aad~l~~i~~L~~~~P~~a~ll~~a~~~L~~vv~s~~~l~--~~ldp~~Ff~~vRPYykP~rVG~~  225 (387)
T PF08933_consen  148 FLDYNTRGILALKRAADALLRIAPLGLSHPAFADLLDEAAQALEDVVESNDYLF--RRLDPERFFYCVRPYYKPYRVGGR  225 (387)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCCTT-TTSCHHHHHHHHHHHHHHHHHHHHHHHH--CCS-HHHHHHHTGGGC--EEETTE
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhccCCCCChHHHHHHHHHHHHHHHHHHHHHHHH--HhCCHHHHHHHhcccccceeeCCe
Confidence            4578999999977774222        222888888 3       344455556  46799999999999888865    


Q ss_pred             ---cCCCCCCCCCCchhH
Q 037219           85 ---GHDIGQFLGLESMEK   99 (109)
Q Consensus        85 ---G~dIGqFPG~~~~~~   99 (109)
                         |..-|+|||+.+-++
T Consensus       226 ~Y~GpnA~d~agi~vIDl  243 (387)
T PF08933_consen  226 SYRGPNAGDFAGINVIDL  243 (387)
T ss_dssp             EE----CCGSCHHHHHHH
T ss_pred             eecCCCccccccchHHHH
Confidence               448899998876544


No 9  
>TIGR02435 CobG precorrin-3B synthase. An iron-sulfur protein. An oxygen atom from dioxygen is incorporated into the macrocycle at C-20. In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively.
Probab=44.99  E-value=28  Score=28.83  Aligned_cols=26  Identities=23%  Similarity=0.300  Sum_probs=18.0

Q ss_pred             HHHHHHHHHhccCC---CCchhhhcccCC
Q 037219           53 ALAEHIVAYLGSHG---VCSEEFDVGLQT   78 (109)
Q Consensus        53 ALA~~Ia~y~~s~~---~~~eefa~GL~~   78 (109)
                      .||+.|+++|....   .=|..|.++++.
T Consensus       109 ~la~~l~~~l~~~~~~~~LPrKfki~vsg  137 (390)
T TIGR02435       109 PLAAELRAALENERALLELPPKFSVAIDG  137 (390)
T ss_pred             HHHHHHHHHHhcChhhhcCCCceEEEEEC
Confidence            89999999995432   225667777654


No 10 
>PF11294 DUF3095:  Protein of unknown function (DUF3095);  InterPro: IPR021445  Some members in this bacterial family of proteins are annotated as adenylyl cyclase however this cannot be confirmed. Currently no function is known. 
Probab=44.86  E-value=47  Score=28.76  Aligned_cols=66  Identities=23%  Similarity=0.217  Sum_probs=43.0

Q ss_pred             CCChhhHHHHHHHHHH----HHHHhcccchh------------------------------hhhhHHHHHHHHHH---Hh
Q 037219           20 NFPTATAEKVKTGLVY----VVMAVGFKFRV------------------------------CCLKWLALAEHIVA---YL   62 (109)
Q Consensus        20 nIP~~~AekV~~~Ml~----ve~ALgl~tRv------------------------------iCGDWlALA~~Ia~---y~   62 (109)
                      .||+..++.+++.|.+    +...++|.-||                              +-|+=|+.|++.-.   |.
T Consensus        81 ~vPp~~~~~ar~aLa~~~~~~~~~f~l~LRvg~VPV~~Ir~~G~dvrvAr~~~S~~~~~amf~GgGL~~AE~~mK~~~~~  160 (373)
T PF11294_consen   81 AVPPSLLEAAREALAAVRAWVKEEFDLELRVGLVPVSDIRAEGLDVRVARFAASPNVSYAMFSGGGLAWAEALMKAGRYL  160 (373)
T ss_pred             ecCHHHHHHHHHHHHHHHHHHHHhcCCceeEeeeEHHHHHhCCCeEEEEEEccCCCceEEEEecCcHHHHHHHHhccccc
Confidence            4789999999999887    55557777333                              88999999988754   11


Q ss_pred             ccCCCCchh-hhcccCCcccCCCc
Q 037219           63 GSHGVCSEE-FDVGLQTNILPLKG   85 (109)
Q Consensus        63 ~s~~~~~ee-fa~GL~~~~~p~~G   85 (109)
                      -........ -=-||.+||.|+..
T Consensus       161 i~~~~~~~~pdLtGlsCRW~~Ips  184 (373)
T PF11294_consen  161 IPPAPPGTRPDLTGLSCRWNPIPS  184 (373)
T ss_pred             CCCCCCCCCCCCCCceeeCCcCCC
Confidence            111111111 12489999999843


No 11 
>PLN02576 protoporphyrinogen oxidase
Probab=43.74  E-value=20  Score=29.46  Aligned_cols=18  Identities=22%  Similarity=0.322  Sum_probs=13.8

Q ss_pred             hhhhHH-------------HHHHHHHHHhcc
Q 037219           47 CCLKWL-------------ALAEHIVAYLGS   64 (109)
Q Consensus        47 iCGDWl-------------ALA~~Ia~y~~s   64 (109)
                      +||||+             .+|++|.....+
T Consensus       459 ~aG~~~~g~~i~~ai~sg~~aA~~i~~~~~~  489 (496)
T PLN02576        459 LGGNYRGGVALGKCVESGYEAADLVISYLES  489 (496)
T ss_pred             EeccccCCccHHHHHHHHHHHHHHHHHHHhh
Confidence            899999             778888776543


No 12 
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=41.71  E-value=20  Score=31.41  Aligned_cols=24  Identities=13%  Similarity=0.189  Sum_probs=18.0

Q ss_pred             hhhHHHHHHHHHH-HHHH---hcccchh
Q 037219           23 TATAEKVKTGLVY-VVMA---VGFKFRV   46 (109)
Q Consensus        23 ~~~AekV~~~Ml~-ve~A---Lgl~tRv   46 (109)
                      ++.+.+..++|+. .|..   |+||-||
T Consensus       294 Pe~S~~~~E~m~~~ae~il~~LeLPyRv  321 (429)
T COG0172         294 PEESEEELEEMLGNAEEVLQELELPYRV  321 (429)
T ss_pred             cchhHHHHHHHHHHHHHHHHHhCCCceE
Confidence            4567888899999 5554   7888666


No 13 
>cd08782 Death_DAPK1 Death domain found in death-associated protein kinase 1. Death domain (DD) found in death-associated protein kinase 1 (DAPK1). DAPK1 is composed of several functional domains, including a kinase domain, a CaM regulatory domain, ankyrin repeats, a cytoskeletal binding domain and a C-terminal DD. It plays important roles in a diverse range of signal transduction pathways including apoptosis, growth factor signalling, and autophagy. Loss of DAPK1 expression, usually because of DNA methylation, is implicated in many tumor types. DAPK1 is highly abundant in the brain and has also been associated with neurodegeneration. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as ad
Probab=41.00  E-value=15  Score=24.93  Aligned_cols=17  Identities=18%  Similarity=0.171  Sum_probs=13.4

Q ss_pred             hhhHHHHHHHHH------HHhcc
Q 037219           48 CLKWLALAEHIV------AYLGS   64 (109)
Q Consensus        48 CGDWlALA~~Ia------~y~~s   64 (109)
                      .=||+.||+.|.      .||.+
T Consensus        17 g~DW~~LA~~Lg~~~~~~~~~~~   39 (82)
T cd08782          17 GRDWCLLAVNLGLTDLVPQLDTN   39 (82)
T ss_pred             CCCHHHHHHHcCChhhHHHHHhc
Confidence            559999998877      77754


No 14 
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain. DevT is a component in the C-signal response pathway in Myxococcus xanthus that stimulates the developmentally regulated expression of the FruA response regulator protein and is required for methylation of FrzCD during fruiting body formation.  DevT mutants having an in-frame deletion in the devT gene, display delayed aggregation and a cell autonomous sporulation defect.  DevT belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomy
Probab=40.22  E-value=14  Score=29.57  Aligned_cols=15  Identities=33%  Similarity=0.472  Sum_probs=12.6

Q ss_pred             hhh-hHH---------HHHHHHHHH
Q 037219           47 CCL-KWL---------ALAEHIVAY   61 (109)
Q Consensus        47 iCG-DWl---------ALA~~Ia~y   61 (109)
                      +|| ||.         .||++|+..
T Consensus       167 ~cg~d~~~~~~~~G~~~l~~ai~~~  191 (238)
T cd07397         167 PCGRDWKPPGGDWGDPDLALAISQI  191 (238)
T ss_pred             ccccccCCcCCCCCCHHHHHHHHHH
Confidence            999 999         888888653


No 15 
>PF15295 CCDC50_N:  Coiled-coil domain-containing protein 50  N-terminus
Probab=39.86  E-value=20  Score=27.12  Aligned_cols=13  Identities=31%  Similarity=0.616  Sum_probs=10.8

Q ss_pred             hhhhHH-----HHHHHHH
Q 037219           47 CCLKWL-----ALAEHIV   59 (109)
Q Consensus        47 iCGDWl-----ALA~~Ia   59 (109)
                      +|.||+     |||..+-
T Consensus        17 Vc~~f~V~EDgaLA~~LQ   34 (132)
T PF15295_consen   17 VCREFAVLEDGALAHRLQ   34 (132)
T ss_pred             HHHHHHHhhhHHHHHHHH
Confidence            899999     9997653


No 16 
>TIGR03124 ctirate_citX holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.
Probab=35.14  E-value=28  Score=26.58  Aligned_cols=15  Identities=13%  Similarity=0.093  Sum_probs=13.2

Q ss_pred             hHHHHHHHHHHHHHH
Q 037219           25 TAEKVKTGLVYVVMA   39 (109)
Q Consensus        25 ~AekV~~~Ml~ve~A   39 (109)
                      -|.+||+.|+++|..
T Consensus        88 ~a~~vK~~~i~iEe~  102 (165)
T TIGR03124        88 PALELKRLMIKLEES  102 (165)
T ss_pred             CHHHHHHHHHHHHhC
Confidence            478899999999987


No 17 
>PF11390 FdsD:  NADH-dependant formate dehydrogenase delta subunit FdsD;  InterPro: IPR021074  FdsD is the delta subunit of the enzyme formate dehydrogenase. This subunit may play a role in maintaining the quaternary structure by means of electrostatic interactions with the other subunits []. The delta subunit is not involved in the active centre of the enzyme []. 
Probab=34.87  E-value=25  Score=23.15  Aligned_cols=13  Identities=31%  Similarity=0.506  Sum_probs=11.1

Q ss_pred             HHHHHHHHHhccC
Q 037219           53 ALAEHIVAYLGSH   65 (109)
Q Consensus        53 ALA~~Ia~y~~s~   65 (109)
                      ..||+|++||.+.
T Consensus         4 ~MANQIa~ff~~~   16 (61)
T PF11390_consen    4 KMANQIAAFFESY   16 (61)
T ss_pred             HHHHHHHHHHccC
Confidence            4799999999776


No 18 
>PRK09190 hypothetical protein; Provisional
Probab=32.88  E-value=56  Score=26.05  Aligned_cols=43  Identities=19%  Similarity=0.141  Sum_probs=33.1

Q ss_pred             chhhhhhhCCCCCCCChhhHHHHHHHHHH-HHHHhcccchh---hhhh
Q 037219            7 KRHHGLELGAKKENFPTATAEKVKTGLVY-VVMAVGFKFRV---CCLK   50 (109)
Q Consensus         7 T~~yg~~nKVPQEnIP~~~AekV~~~Ml~-ve~ALgl~tRv---iCGD   50 (109)
                      .+.|.+..|.+-+ +|.+..++|.+.|.+ +=..|||.-|.   ++|+
T Consensus        70 kk~l~Ralk~~v~-v~~~l~~~l~~~l~~ril~lLGLArRAGklVsG~  116 (220)
T PRK09190         70 KKLFARAAKADVK-VPPDLADLVEALLARRALDALGLARKAGQVVSGF  116 (220)
T ss_pred             hChhHHHhCCCCC-CCHHHHHHHHHHHHHHHHHHHHHHhhhCCEeecH
Confidence            3567888887433 789999999999888 88899999544   6664


No 19 
>PF01964 ThiC:  ThiC family;  InterPro: IPR002817 ThiC is found within the thiamin biosynthesis operon. ThiC is involved in thiamin biosynthesis []. The precise catalytic function of ThiC is still not known. ThiC participates in the formation of 4-Amino-5-hydroxymethyl-2-methylpyrimidine from AIR, an intermediate in the de novo pyrimidine biosynthesis.; GO: 0009228 thiamine biosynthetic process; PDB: 3EPO_A 3EPN_B 3EPM_B.
Probab=31.24  E-value=56  Score=29.01  Aligned_cols=23  Identities=26%  Similarity=0.401  Sum_probs=16.8

Q ss_pred             CCCCCChhhHHHHHHHHHHHHHH
Q 037219           17 KKENFPTATAEKVKTGLVYVVMA   39 (109)
Q Consensus        17 PQEnIP~~~AekV~~~Ml~ve~A   39 (109)
                      |.|++==-+.+.|++++.+...|
T Consensus       326 PaEHL~LP~~eDV~eGviA~kIA  348 (420)
T PF01964_consen  326 PAEHLGLPTPEDVREGVIASKIA  348 (420)
T ss_dssp             TTTTTS---HHHHHHHHHHHHHH
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHH
Confidence            88887777889999999986665


No 20 
>PF01841 Transglut_core:  Transglutaminase-like superfamily;  InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the epsilon-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Tranglutaminases have been found in a diverse range of species, from bacteria through to mammals. The enzymes require calcium binding and their activity leads to post-translational modification of proteins through acyl-transfer reactions, involving peptidyl glutamine residues as acyl donors and a variety of primary amines as acyl acceptors, with the generation of proteinase resistant isopeptide bonds [].  Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterised transglutaminase, the human blood clotting factor XIIIa' []. On the basis of the experimentally demonstrated activity of the Methanobacterium phage psiM2 pseudomurein endoisopeptidase [], it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease [].  A subunit of plasma Factor XIII revealed that each Factor XIIIA subunit is composed of four domains (termed N-terminal beta-sandwich, core domain (containing the catalytic and the regulatory sites), and C-terminal beta-barrels 1 and 2) and that two monomers assemble into the native dimer through the surfaces in domains 1 and 2, in opposite orientation. This organisation in four domains is highly conserved during evolution among transglutaminase isoforms [].; PDB: 2F4M_A 2F4O_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B ....
Probab=29.21  E-value=32  Score=22.06  Aligned_cols=20  Identities=25%  Similarity=0.223  Sum_probs=12.5

Q ss_pred             HHHH-HHHHhcccchhhhhhH
Q 037219           32 GLVY-VVMAVGFKFRVCCLKW   51 (109)
Q Consensus        32 ~Ml~-ve~ALgl~tRviCGDW   51 (109)
                      .++. +=.++|+|+|++.|..
T Consensus        59 ~l~~allr~~Gipar~v~g~~   79 (113)
T PF01841_consen   59 SLFVALLRALGIPARVVSGYV   79 (113)
T ss_dssp             HHHHHHHHHHT--EEEEEEEE
T ss_pred             HHHHHHHhhCCCceEEEEEEc
Confidence            3444 7778899999877754


No 21 
>smart00460 TGc Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
Probab=28.39  E-value=37  Score=20.10  Aligned_cols=15  Identities=20%  Similarity=0.250  Sum_probs=12.4

Q ss_pred             HHHHhcccchhhhhh
Q 037219           36 VVMAVGFKFRVCCLK   50 (109)
Q Consensus        36 ve~ALgl~tRviCGD   50 (109)
                      +=.++|+|+|++.|.
T Consensus        19 llr~~GIpar~v~g~   33 (68)
T smart00460       19 LLRSLGIPARVVSGY   33 (68)
T ss_pred             HHHHCCCCeEEEeee
Confidence            667889999998874


No 22 
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only]
Probab=25.99  E-value=45  Score=25.58  Aligned_cols=13  Identities=46%  Similarity=0.774  Sum_probs=11.4

Q ss_pred             hhhHHHHHHHHHH
Q 037219           48 CLKWLALAEHIVA   60 (109)
Q Consensus        48 CGDWlALA~~Ia~   60 (109)
                      --||.|||+++.+
T Consensus        79 ~edW~alaerlea   91 (138)
T COG3565          79 VEDWFALAERLEA   91 (138)
T ss_pred             HHHHHHHHHHHHH
Confidence            3499999999987


No 23 
>PF15463 ECM11:  Extracellular mutant protein 11
Probab=25.46  E-value=55  Score=23.78  Aligned_cols=6  Identities=17%  Similarity=0.545  Sum_probs=5.8

Q ss_pred             hhhhHH
Q 037219           47 CCLKWL   52 (109)
Q Consensus        47 iCGDWl   52 (109)
                      -||||+
T Consensus        76 ~~Gd~~   81 (139)
T PF15463_consen   76 EAGDWF   81 (139)
T ss_pred             HHHHHH
Confidence            899999


No 24 
>PF03802 CitX:  Apo-citrate lyase phosphoribosyl-dephospho-CoA transferase;  InterPro: IPR005551 Members of this protein family are annotated as CitX, containing the CitX domain, the domain is also found in the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25 from EC), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems.; GO: 0051191 prosthetic group biosynthetic process
Probab=23.69  E-value=57  Score=24.69  Aligned_cols=15  Identities=27%  Similarity=0.282  Sum_probs=13.3

Q ss_pred             hHHHHHHHHHHHHHH
Q 037219           25 TAEKVKTGLVYVVMA   39 (109)
Q Consensus        25 ~AekV~~~Ml~ve~A   39 (109)
                      .|..||+.|+.+|..
T Consensus        90 ~a~~vK~~~i~iEe~  104 (170)
T PF03802_consen   90 DAEEVKRIMIEIEES  104 (170)
T ss_pred             CHHHHHHHHHHHHcc
Confidence            388999999999987


No 25 
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=23.43  E-value=67  Score=19.20  Aligned_cols=13  Identities=15%  Similarity=0.468  Sum_probs=10.1

Q ss_pred             CCCChhhHHHHHH
Q 037219           19 ENFPTATAEKVKT   31 (109)
Q Consensus        19 EnIP~~~AekV~~   31 (109)
                      ++||+++|++|+.
T Consensus        20 d~v~~~Ka~~im~   32 (36)
T PF06200_consen   20 DDVPPDKAQEIML   32 (36)
T ss_pred             CCCCHHHHHHHHH
Confidence            5788888888764


No 26 
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]
Probab=21.91  E-value=1.2e+02  Score=25.84  Aligned_cols=54  Identities=15%  Similarity=0.153  Sum_probs=37.5

Q ss_pred             CCChhhHHHHHHHHHHHHHHhccc-----chh--------------hhhhHHHHHHHHHHHhccCCCCchhhhcccCC
Q 037219           20 NFPTATAEKVKTGLVYVVMAVGFK-----FRV--------------CCLKWLALAEHIVAYLGSHGVCSEEFDVGLQT   78 (109)
Q Consensus        20 nIP~~~AekV~~~Ml~ve~ALgl~-----tRv--------------iCGDWlALA~~Ia~y~~s~~~~~eefa~GL~~   78 (109)
                      .|+.+++++|.++|=    -.||+     .+|              .|.|=+.||++|.+||- ...-|-.|-+-+.-
T Consensus        74 ~i~~e~~~~v~~~L~----~iG~~~G~~G~~vr~i~aC~G~~~C~~a~~Dt~~la~~l~e~f~-~~~~P~KfKI~vsG  146 (317)
T COG2221          74 GISPEDADDVVEELR----EIGLPVGSTGPAVRAIVACPGPRTCETALYDTTELARRLEEEFL-EVPVPYKFKIAVSG  146 (317)
T ss_pred             cCCHHHHHHHHHHHH----HcCCCCCCcchhhhhhhcCcCcccccccccChHHHHHHHHHHhh-cCCCCceEEEEeec
Confidence            377788888776654    34455     222              67777799999999997 55667777776643


No 27 
>PF10686 DUF2493:  Protein of unknown function (DUF2493);  InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family are mainly Proteobacteria. The function is not known. 
Probab=21.77  E-value=32  Score=22.64  Aligned_cols=17  Identities=24%  Similarity=0.311  Sum_probs=14.8

Q ss_pred             hhhhhhhCCCCCCCChh
Q 037219            8 RHHGLELGAKKENFPTA   24 (109)
Q Consensus         8 ~~yg~~nKVPQEnIP~~   24 (109)
                      ..|+++++||++.+|++
T Consensus        50 ~~wA~~~gv~~~~~~ad   66 (71)
T PF10686_consen   50 ARWARERGVPVIRFPAD   66 (71)
T ss_pred             HHHHHHCCCeeEEeCcC
Confidence            46899999999999875


No 28 
>cd08312 Death_MyD88 Death domain of Myeloid Differentation primary response protein MyD88. Death Domain (DD) of Myeloid Differentiation primary response protein 88 (MyD88). MyD88 is an adaptor protein involved in interleukin-1 receptor (IL-1R)- and Toll-like receptor (TLR)-induced activation of nuclear factor-kappaB (NF-kB) and mitogen activated protein kinase pathways that lead to the induction of proinflammatory cytokines. It is a key component in the signaling pathway of pathogen recognition in the innate immune system. MyD88 contains an N-terminal DD and a C-terminal Toll/IL-1 Receptor (TIR) homology domain that mediates interaction with TLRs and IL-1R. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and
Probab=21.56  E-value=49  Score=21.90  Aligned_cols=12  Identities=42%  Similarity=0.778  Sum_probs=9.7

Q ss_pred             hhhhHHHHHHHH
Q 037219           47 CCLKWLALAEHI   58 (109)
Q Consensus        47 iCGDWlALA~~I   58 (109)
                      ..=||..||+++
T Consensus        15 ~g~DWr~LA~~L   26 (79)
T cd08312          15 VAADWTALAEEM   26 (79)
T ss_pred             cccCHHHHHHHc
Confidence            345999999987


No 29 
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=21.40  E-value=92  Score=24.55  Aligned_cols=55  Identities=20%  Similarity=0.081  Sum_probs=35.0

Q ss_pred             HHHHHHHHHhccCCCCchhhhcccCCcccCCCcCCCCCCCCCCchhHHHHhhccc
Q 037219           53 ALAEHIVAYLGSHGVCSEEFDVGLQTNILPLKGHDIGQFLGLESMEKVEAQAYQP  107 (109)
Q Consensus        53 ALA~~Ia~y~~s~~~~~eefa~GL~~~~~p~~G~dIGqFPG~~~~~~~e~~~~~~  107 (109)
                      .|+.+|..-+.+...+-++.|.---.-=+.-.|.|+|.|-+=.-+.--|.++|.+
T Consensus        87 ~llk~~~~~l~~g~~~f~elA~q~SdCSSaKRGGDLG~fgrgqMqk~FEdaafaL  141 (163)
T KOG3259|consen   87 DLLKGYHEDLKSGSGDFEELAKQRSDCSSAKRGGDLGFFGRGQMQKPFEDAAFAL  141 (163)
T ss_pred             HHHHHhHHHhhcCcccHHHHHHhhcChhhhccCCcccccccccccccchhhhhhc
Confidence            4566666666666666666666555555666788999997655444445555544


No 30 
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain. This domain is common to all eyes absent (EYA) homologs. Metazoan EYA's also contain a variable N-terminal domain consisting largely of low-complexity sequences.
Probab=20.85  E-value=66  Score=27.18  Aligned_cols=69  Identities=14%  Similarity=0.054  Sum_probs=46.9

Q ss_pred             hhhhhCCCCCCCChhhHHHHHH-HHHH-HHHHhccc--chhhhhhHHHHHHHHHHHhccCCCCchhhhcccCCcccCCCc
Q 037219           10 HGLELGAKKENFPTATAEKVKT-GLVY-VVMAVGFK--FRVCCLKWLALAEHIVAYLGSHGVCSEEFDVGLQTNILPLKG   85 (109)
Q Consensus        10 yg~~nKVPQEnIP~~~AekV~~-~Ml~-ve~ALgl~--tRviCGDWlALA~~Ia~y~~s~~~~~eefa~GL~~~~~p~~G   85 (109)
                      ||...=+|-|||..+..  |-+ .-.+ +....|-|  +=++.||               |...+++|.-|+-+|-++..
T Consensus       196 y~L~~~f~ieNIYSa~k--vGK~~cFe~I~~Rfg~p~~~f~~IGD---------------G~eEe~aAk~l~wPFw~I~~  258 (274)
T TIGR01658       196 FRLDTIFRIENVYSSIK--VGKLQCFKWIKERFGHPKVRFCAIGD---------------GWEECTAAQAMNWPFVKIDL  258 (274)
T ss_pred             hccCCccccccccchhh--cchHHHHHHHHHHhCCCCceEEEeCC---------------ChhHHHHHHhcCCCeEEeec
Confidence            78888889999987653  322 2222 33445553  2235565               66777889999999999999


Q ss_pred             C--CCCCCCCCC
Q 037219           86 H--DIGQFLGLE   95 (109)
Q Consensus        86 ~--dIGqFPG~~   95 (109)
                      |  -.-.||+++
T Consensus       259 h~Dl~~l~~aL~  270 (274)
T TIGR01658       259 HPDSSHRFPGLT  270 (274)
T ss_pred             CCCHHHhCccCC
Confidence            8  345788876


Done!