BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037231
         (108 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1SNZ|A Chain A, Crystal Structure Of Apo Human Galactose Mutarotase
 pdb|1SNZ|B Chain B, Crystal Structure Of Apo Human Galactose Mutarotase
 pdb|1SO0|A Chain A, Crystal Structure Of Human Galactose Mutarotase Complexed
           With Galactose
 pdb|1SO0|B Chain B, Crystal Structure Of Human Galactose Mutarotase Complexed
           With Galactose
 pdb|1SO0|C Chain C, Crystal Structure Of Human Galactose Mutarotase Complexed
           With Galactose
 pdb|1SO0|D Chain D, Crystal Structure Of Human Galactose Mutarotase Complexed
           With Galactose
          Length = 344

 Score = 26.2 bits (56), Expect = 5.0,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 34  RIEDENEMSMPTEES---RRHLNAGQDCISYDAMLANKVPCSLKGHSYYD 80
           RI  + E   P E        L+ G+  ++Y A  +   P +L  HSY++
Sbjct: 133 RISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN 182


>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase
           Containing The Ferm And Kinase Domains.
 pdb|2J0K|B Chain B, Crystal Structure Of A Fragment Of Focal Adhesion Kinase
           Containing The Ferm And Kinase Domains
          Length = 656

 Score = 25.8 bits (55), Expect = 6.3,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 25  GIKSINVVGRIEDENEMSMPTEESRRHLNAGQDCISYD 62
           G+K+ +V+GRIE+   + MP        +    C +YD
Sbjct: 595 GVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYD 632


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.126    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,763,971
Number of Sequences: 62578
Number of extensions: 89041
Number of successful extensions: 61
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 61
Number of HSP's gapped (non-prelim): 12
length of query: 108
length of database: 14,973,337
effective HSP length: 72
effective length of query: 36
effective length of database: 10,467,721
effective search space: 376837956
effective search space used: 376837956
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 45 (21.9 bits)