BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037234
(81 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1YJ9|R Chain R, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
Haloarcula Marismortui Containing A Three Residue
Deletion In L22
Length = 152
Score = 26.6 bits (57), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 4/71 (5%)
Query: 9 CGKPFAVKGDWRTHEKNCGRIWYCVCGSDFKHKRSLKDHIKAFGHGHAALGIECFEEDDE 68
G ++V+ D T K R FKH +++ IK G A +E E D+
Sbjct: 1 MGISYSVEADPDTTAKAMLRERQM----SFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQ 56
Query: 69 PASEIEHDGGI 79
P +H+ G+
Sbjct: 57 PVPFKQHNSGV 67
>pdb|1S72|R Chain R, Refined Crystal Structure Of The Haloarcula Marismortui
Large Ribosomal Subunit At 2.4 Angstrom Resolution
pdb|1YHQ|R Chain R, Crystal Structure Of Azithromycin Bound To The G2099a
Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1YI2|R Chain R, Crystal Structure Of Erythromycin Bound To The G2099a
Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1YIJ|R Chain R, Crystal Structure Of Telithromycin Bound To The G2099a
Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1YIT|R Chain R, Crystal Structure Of Virginiamycin M And S Bound To The
50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1YJN|R Chain R, Crystal Structure Of Clindamycin Bound To The G2099a
Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1YJW|R Chain R, Crystal Structure Of Quinupristin Bound To The G2099a
Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
pdb|1VQ4|R Chain R, The Structure Of The Transition State Analogue "daa"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1VQ5|R Chain R, The Structure Of The Transition State Analogue "raa"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1VQ6|R Chain R, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
Large Ribosomal Subunit Of Haloarcula Marismortui
pdb|1VQ7|R Chain R, The Structure Of The Transition State Analogue "dca"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1VQ8|R Chain R, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
Sparsomycin Bound To The Large Ribosomal Subunit Of
Haloarcula Marismortui
pdb|1VQ9|R Chain R, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
Sparsomycin Bound To The Large Ribosomal Subunit Of
Haloarcula Marismortui
pdb|1VQK|R Chain R, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
The Ribosomal Subunit Of Haloarcula Marismortui
pdb|1VQL|R Chain R, The Structure Of The Transition State Analogue "dcsn"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1VQM|R Chain R, The Structure Of The Transition State Analogue "dan"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1VQN|R Chain R, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To
The Large Ribosomal Subunit Of Haloarcula Marismortui
pdb|1VQO|R Chain R, The Structure Of Ccpmn Bound To The Large Ribosomal
Subunit Haloarcula Marismortui
pdb|1VQP|R Chain R, The Structure Of The Transition State Analogue "rap"
Bound To The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|2OTJ|R Chain R, 13-Deoxytedanolide Bound To The Large Subunit Of
Haloarcula Marismortui
pdb|2OTL|R Chain R, Girodazole Bound To The Large Subunit Of Haloarcula
Marismortui
pdb|2QA4|R Chain R, A More Complete Structure Of The The L7L12 STALK OF THE
Haloarcula Marismortui 50s Large Ribosomal Subunit
pdb|3CC2|R Chain R, The Refined Crystal Structure Of The Haloarcula
Marismortui Large Ribosomal Subunit At 2.4 Angstrom
Resolution With Rrna Sequence For The 23s Rrna And
Genome-Derived Sequences For R-Proteins
pdb|3CC4|R Chain R, Co-Crystal Structure Of Anisomycin Bound To The 50s
Ribosomal Subunit
pdb|3CC7|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation C2487u
pdb|3CCE|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation U2535a
pdb|3CCJ|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation C2534u
pdb|3CCL|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation U2535c. Density For Anisomycin Is
Visible But Not Included In Model.
pdb|3CCM|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation G2611u
pdb|3CCQ|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation A2488u
pdb|3CCR|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation A2488c. Density For Anisomycin Is
Visible But Not Included In The Model.
pdb|3CCS|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation G2482a
pdb|3CCU|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation G2482c
pdb|3CCV|R Chain R, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
23s Rrna Mutation G2616a
pdb|3CD6|R Chain R, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
Cc-puromycin
pdb|3CPW|Q Chain Q, The Structure Of The Antibiotic Linezolid Bound To The
Large Ribosomal Subunit Of Haloarcula Marismortui
pdb|3CMA|R Chain R, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
Large Ribosomal Subunit Of Haloarcula Marismortui
pdb|3CME|R Chain R, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The
Large Ribosomal Subunit Of Haloarcula Marismortui
pdb|2QEX|R Chain R, Negamycin Binds To The Wall Of The Nascent Chain Exit
Tunnel Of The 50s Ribosomal Subunit
pdb|3I55|R Chain R, Co-Crystal Structure Of Mycalamide A Bound To The Large
Ribosomal Subunit
pdb|3I56|R Chain R, Co-Crystal Structure Of Triacetyloleandomcyin Bound To
The Large Ribosomal Subunit
pdb|4ADX|R Chain R, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
Subunit In Complex With Initiation Factor 6
Length = 155
Score = 26.6 bits (57), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 4/71 (5%)
Query: 9 CGKPFAVKGDWRTHEKNCGRIWYCVCGSDFKHKRSLKDHIKAFGHGHAALGIECFEEDDE 68
G ++V+ D T K R FKH +++ IK G A +E E D+
Sbjct: 1 MGISYSVEADPDTTAKAMLRERQM----SFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQ 56
Query: 69 PASEIEHDGGI 79
P +H+ G+
Sbjct: 57 PVPFKQHNSGV 67
>pdb|3G4S|R Chain R, Co-Crystal Structure Of Tiamulin Bound To The Large
Ribosomal Subunit
pdb|3G6E|R Chain R, Co-Crystal Structure Of Homoharringtonine Bound To The
Large Ribosomal Subunit
pdb|3G71|R Chain R, Co-crystal Structure Of Bruceantin Bound To The Large
Ribosomal Subunit
pdb|3OW2|Q Chain Q, Crystal Structure Of Enhanced Macrolide Bound To 50s
Ribosomal Subunit
Length = 150
Score = 26.6 bits (57), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 13/42 (30%), Positives = 21/42 (50%)
Query: 38 FKHKRSLKDHIKAFGHGHAALGIECFEEDDEPASEIEHDGGI 79
FKH +++ IK G A +E E D+P +H+ G+
Sbjct: 25 FKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGV 66
>pdb|1FFK|O Chain O, Crystal Structure Of The Large Ribosomal Subunit From
Haloarcula Marismortui At 2.4 Angstrom Resolution
pdb|1JJ2|Q Chain Q, Fully Refined Crystal Structure Of The Haloarcula
Marismortui Large Ribosomal Subunit At 2.4 Angstrom
Resolution
pdb|1KQS|Q Chain Q, The Haloarcula Marismortui 50s Complexed With A
Pretranslocational Intermediate In Protein Synthesis
pdb|1K8A|S Chain S, Co-Crystal Structure Of Carbomycin A Bound To The 50s
Ribosomal Subunit Of Haloarcula Marismortui
pdb|1K9M|S Chain S, Co-Crystal Structure Of Tylosin Bound To The 50s
Ribosomal Subunit Of Haloarcula Marismortui
pdb|1KD1|S Chain S, Co-crystal Structure Of Spiramycin Bound To The 50s
Ribosomal Subunit Of Haloarcula Marismortui
pdb|1M1K|S Chain S, Co-Crystal Structure Of Azithromycin Bound To The 50s
Ribosomal Subunit Of Haloarcula Marismortui
pdb|1M90|S Chain S, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
Sparsomycin Bound To The 50s Ribosomal Subunit
pdb|1K73|S Chain S, Co-Crystal Structure Of Anisomycin Bound To The 50s
Ribosomal Subunit
pdb|1KC8|S Chain S, Co-Crystal Structure Of Blasticidin S Bound To The 50s
Ribosomal Subunit
pdb|1N8R|S Chain S, Structure Of Large Ribosomal Subunit In Complex With
Virginiamycin M
pdb|1NJI|S Chain S, Structure Of Chloramphenicol Bound To The 50s Ribosomal
Subunit
pdb|1Q7Y|S Chain S, Crystal Structure Of Ccdap-puromycin Bound At The
Peptidyl Transferase Center Of The 50s Ribosomal
Subunit
pdb|1Q81|S Chain S, Crystal Structure Of Minihelix With 3' Puromycin Bound
To A- Site Of The 50s Ribosomal Subunit.
pdb|1Q82|S Chain S, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
The 50s Ribosomal Subunit
pdb|1Q86|S Chain S, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
Simultaneously At Half Occupancy To Both The A-Site And
P- Site Of The The 50s Ribosomal Subunit.
pdb|1QVF|Q Chain Q, Structure Of A Deacylated Trna Minihelix Bound To The E
Site Of The Large Ribosomal Subunit Of Haloarcula
Marismortui
pdb|1QVG|Q Chain Q, Structure Of Cca Oligonucleotide Bound To The Trna
Binding Sites Of The Large Ribosomal Subunit Of
Haloarcula Marismortui
pdb|1W2B|Q Chain Q, Trigger Factor Ribosome Binding Domain In Complex With
50s
pdb|3CXC|Q Chain Q, The Structure Of An Enhanced Oxazolidinone Inhibitor
Bound To The 50s Ribosomal Subunit Of H. Marismortui
Length = 154
Score = 26.6 bits (57), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 13/42 (30%), Positives = 21/42 (50%)
Query: 38 FKHKRSLKDHIKAFGHGHAALGIECFEEDDEPASEIEHDGGI 79
FKH +++ IK G A +E E D+P +H+ G+
Sbjct: 25 FKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGV 66
>pdb|4G1B|A Chain A, X-Ray Structure Of Yeast Flavohemoglobin In Complex With
Econazole
pdb|4G1B|B Chain B, X-Ray Structure Of Yeast Flavohemoglobin In Complex With
Econazole
pdb|4G1B|C Chain C, X-Ray Structure Of Yeast Flavohemoglobin In Complex With
Econazole
pdb|4G1B|D Chain D, X-Ray Structure Of Yeast Flavohemoglobin In Complex With
Econazole
pdb|4G1V|A Chain A, X-Ray Structure Of Yeast Flavohemoglobin
Length = 399
Score = 25.8 bits (55), Expect = 6.6, Method: Composition-based stats.
Identities = 10/18 (55%), Positives = 12/18 (66%)
Query: 44 LKDHIKAFGHGHAALGIE 61
L DH+K GH H AL I+
Sbjct: 74 LMDHVKQIGHKHRALQIK 91
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.139 0.469
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,817,880
Number of Sequences: 62578
Number of extensions: 97633
Number of successful extensions: 261
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 251
Number of HSP's gapped (non-prelim): 17
length of query: 81
length of database: 14,973,337
effective HSP length: 50
effective length of query: 31
effective length of database: 11,844,437
effective search space: 367177547
effective search space used: 367177547
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)