BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037236
         (953 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|13PK|A Chain A, Ternary Complex Of Phosphoglycerate Kinase From
           Trypanosoma Brucei
 pdb|13PK|B Chain B, Ternary Complex Of Phosphoglycerate Kinase From
           Trypanosoma Brucei
 pdb|13PK|C Chain C, Ternary Complex Of Phosphoglycerate Kinase From
           Trypanosoma Brucei
 pdb|13PK|D Chain D, Ternary Complex Of Phosphoglycerate Kinase From
           Trypanosoma Brucei
 pdb|16PK|A Chain A, Phosphoglycerate Kinase From Trypanosoma Brucei
           Bisubstrate Analog
          Length = 415

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 887 LLKTTKDLTLRVCKNLRICVDCHNAAKLISKVAEREIVIRDNKRFH 932
           L    K L+  + + +    DC NAA ++SK++  ++V+ +N RF+
Sbjct: 88  LKPVAKRLSELLLRPVTFAPDCLNAADVVSKMSPGDVVLLENVRFY 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 26,110,217
Number of Sequences: 62578
Number of extensions: 1019040
Number of successful extensions: 2498
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2496
Number of HSP's gapped (non-prelim): 2
length of query: 953
length of database: 14,973,337
effective HSP length: 108
effective length of query: 845
effective length of database: 8,214,913
effective search space: 6941601485
effective search space used: 6941601485
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.2 bits)