BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 037250
         (277 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
           From Mesorhizobium Loti
 pdb|3NDR|B Chain B, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
           From Mesorhizobium Loti
 pdb|3NDR|C Chain C, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
           From Mesorhizobium Loti
 pdb|3NDR|D Chain D, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
           From Mesorhizobium Loti
          Length = 247

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 218 MSWD------WRKILEVLILGQFVVEKVMEAAQASAGMSGTFI 254
           ++WD      WRKI++V + G F+V +       +AG +G  I
Sbjct: 94  VAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQXRAAGKAGRVI 136


>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal
           4-Dehydrogenase From Mesorhizobium Loti
 pdb|3NUG|B Chain B, Crystal Structure Of Wild Type Tetrameric Pyridoxal
           4-Dehydrogenase From Mesorhizobium Loti
 pdb|3NUG|C Chain C, Crystal Structure Of Wild Type Tetrameric Pyridoxal
           4-Dehydrogenase From Mesorhizobium Loti
 pdb|3NUG|D Chain D, Crystal Structure Of Wild Type Tetrameric Pyridoxal
           4-Dehydrogenase From Mesorhizobium Loti
 pdb|3RWB|A Chain A, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
           And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
           Mesorhizobium Loti
 pdb|3RWB|B Chain B, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
           And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
           Mesorhizobium Loti
 pdb|3RWB|C Chain C, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
           And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
           Mesorhizobium Loti
 pdb|3RWB|D Chain D, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
           And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
           Mesorhizobium Loti
          Length = 247

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)

Query: 218 MSWD------WRKILEVLILGQFVVEKVMEAAQASAGMSGTFI 254
           ++WD      WRKI++V + G F+V +       +AG +G  I
Sbjct: 94  VAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVI 136


>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Complexed With Nitric Oxide
 pdb|3RGP|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Complexed With Nitric Oxide
 pdb|3RGP|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Complexed With Nitric Oxide
 pdb|3RGP|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Complexed With Nitric Oxide
 pdb|3RGS|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
           With The Ammonia As A Ligand
 pdb|3RGS|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
           With The Ammonia As A Ligand
 pdb|3RGS|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
           With The Ammonia As A Ligand
 pdb|3RGS|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
           With The Ammonia As A Ligand
 pdb|3RE8|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Interacting With Nitric Oxide
 pdb|3RE8|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Interacting With Nitric Oxide
 pdb|3RE8|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Interacting With Nitric Oxide
 pdb|3RE8|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
           Interacting With Nitric Oxide
          Length = 499

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 6   FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
           F L  V PH  +  +P+  L ++  P N+    + ++ L+  P  N+P  + P   P   
Sbjct: 294 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 347

Query: 66  LRSRL 70
           L+ RL
Sbjct: 348 LQGRL 352


>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase
 pdb|8CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase
 pdb|8CAT|B Chain B, The Nadph Binding Site On Beef Liver Catalase
 pdb|4BLC|A Chain A, The Structure Of Orthorhombic Crystals Of Beef Liver
           Catalase
 pdb|4BLC|B Chain B, The Structure Of Orthorhombic Crystals Of Beef Liver
           Catalase
 pdb|4BLC|C Chain C, The Structure Of Orthorhombic Crystals Of Beef Liver
           Catalase
 pdb|4BLC|D Chain D, The Structure Of Orthorhombic Crystals Of Beef Liver
           Catalase
 pdb|1TGU|A Chain A, The Crystal Structure Of Bovine Liver Catalase Without
           Nadph
 pdb|1TGU|B Chain B, The Crystal Structure Of Bovine Liver Catalase Without
           Nadph
 pdb|1TGU|C Chain C, The Crystal Structure Of Bovine Liver Catalase Without
           Nadph
 pdb|1TGU|D Chain D, The Crystal Structure Of Bovine Liver Catalase Without
           Nadph
 pdb|1TH2|A Chain A, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With Azide
 pdb|1TH2|B Chain B, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With Azide
 pdb|1TH2|C Chain C, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With Azide
 pdb|1TH2|D Chain D, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With Azide
 pdb|1TH3|A Chain A, Crystal Structure Of Nadph Depleted Bovine Live Catalase
           Complexed With Cyanide
 pdb|1TH3|B Chain B, Crystal Structure Of Nadph Depleted Bovine Live Catalase
           Complexed With Cyanide
 pdb|1TH3|C Chain C, Crystal Structure Of Nadph Depleted Bovine Live Catalase
           Complexed With Cyanide
 pdb|1TH3|D Chain D, Crystal Structure Of Nadph Depleted Bovine Live Catalase
           Complexed With Cyanide
 pdb|1TH4|A Chain A, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With 3-Amino-1,2,4-Triazole
 pdb|1TH4|B Chain B, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With 3-Amino-1,2,4-Triazole
 pdb|1TH4|C Chain C, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With 3-Amino-1,2,4-Triazole
 pdb|1TH4|D Chain D, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
           Complexed With 3-Amino-1,2,4-Triazole
 pdb|7CAT|B Chain B, The Nadph Binding Site On Beef Liver Catalase
          Length = 506

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 6   FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
           F L  V PH  +  +P+  L ++  P N+    + ++ L+  P  N+P  + P   P   
Sbjct: 296 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 349

Query: 66  LRSRL 70
           L+ RL
Sbjct: 350 LQGRL 354


>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver
           Catalase Previously Characterized By Electron Microscopy
 pdb|3NWL|B Chain B, The Crystal Structure Of The P212121 Form Of Bovine Liver
           Catalase Previously Characterized By Electron Microscopy
 pdb|3NWL|C Chain C, The Crystal Structure Of The P212121 Form Of Bovine Liver
           Catalase Previously Characterized By Electron Microscopy
 pdb|3NWL|D Chain D, The Crystal Structure Of The P212121 Form Of Bovine Liver
           Catalase Previously Characterized By Electron Microscopy
          Length = 527

 Score = 28.9 bits (63), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 6   FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
           F L  V PH  +  +P+  L ++  P N+    + ++ L+  P  N+P  + P   P   
Sbjct: 297 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 350

Query: 66  LRSRL 70
           L+ RL
Sbjct: 351 LQGRL 355


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.138    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,968,885
Number of Sequences: 62578
Number of extensions: 304686
Number of successful extensions: 698
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 696
Number of HSP's gapped (non-prelim): 5
length of query: 277
length of database: 14,973,337
effective HSP length: 98
effective length of query: 179
effective length of database: 8,840,693
effective search space: 1582484047
effective search space used: 1582484047
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)