BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 037250
(277 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
From Mesorhizobium Loti
pdb|3NDR|B Chain B, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
From Mesorhizobium Loti
pdb|3NDR|C Chain C, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
From Mesorhizobium Loti
pdb|3NDR|D Chain D, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase
From Mesorhizobium Loti
Length = 247
Score = 30.0 bits (66), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)
Query: 218 MSWD------WRKILEVLILGQFVVEKVMEAAQASAGMSGTFI 254
++WD WRKI++V + G F+V + +AG +G I
Sbjct: 94 VAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQXRAAGKAGRVI 136
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal
4-Dehydrogenase From Mesorhizobium Loti
pdb|3NUG|B Chain B, Crystal Structure Of Wild Type Tetrameric Pyridoxal
4-Dehydrogenase From Mesorhizobium Loti
pdb|3NUG|C Chain C, Crystal Structure Of Wild Type Tetrameric Pyridoxal
4-Dehydrogenase From Mesorhizobium Loti
pdb|3NUG|D Chain D, Crystal Structure Of Wild Type Tetrameric Pyridoxal
4-Dehydrogenase From Mesorhizobium Loti
pdb|3RWB|A Chain A, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
Mesorhizobium Loti
pdb|3RWB|B Chain B, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
Mesorhizobium Loti
pdb|3RWB|C Chain C, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
Mesorhizobium Loti
pdb|3RWB|D Chain D, Crystal Structure Of Complex Of 4pal (4-Pyridoxolactone)
And Pldh (Tetrameric Pyridoxal 4-Dehydrogenase) From
Mesorhizobium Loti
Length = 247
Score = 29.6 bits (65), Expect = 1.9, Method: Compositional matrix adjust.
Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 6/43 (13%)
Query: 218 MSWD------WRKILEVLILGQFVVEKVMEAAQASAGMSGTFI 254
++WD WRKI++V + G F+V + +AG +G I
Sbjct: 94 VAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVI 136
>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
Complexed With Nitric Oxide
pdb|3RGP|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
Complexed With Nitric Oxide
pdb|3RGP|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
Complexed With Nitric Oxide
pdb|3RGP|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
Complexed With Nitric Oxide
pdb|3RGS|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
With The Ammonia As A Ligand
pdb|3RGS|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
With The Ammonia As A Ligand
pdb|3RGS|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
With The Ammonia As A Ligand
pdb|3RGS|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
With The Ammonia As A Ligand
pdb|3RE8|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase
Interacting With Nitric Oxide
pdb|3RE8|B Chain B, Structural And Kinetic Analysis Of The Beef Liver Catalase
Interacting With Nitric Oxide
pdb|3RE8|C Chain C, Structural And Kinetic Analysis Of The Beef Liver Catalase
Interacting With Nitric Oxide
pdb|3RE8|D Chain D, Structural And Kinetic Analysis Of The Beef Liver Catalase
Interacting With Nitric Oxide
Length = 499
Score = 28.9 bits (63), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Query: 6 FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
F L V PH + +P+ L ++ P N+ + ++ L+ P N+P + P P
Sbjct: 294 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 347
Query: 66 LRSRL 70
L+ RL
Sbjct: 348 LQGRL 352
>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase
pdb|8CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase
pdb|8CAT|B Chain B, The Nadph Binding Site On Beef Liver Catalase
pdb|4BLC|A Chain A, The Structure Of Orthorhombic Crystals Of Beef Liver
Catalase
pdb|4BLC|B Chain B, The Structure Of Orthorhombic Crystals Of Beef Liver
Catalase
pdb|4BLC|C Chain C, The Structure Of Orthorhombic Crystals Of Beef Liver
Catalase
pdb|4BLC|D Chain D, The Structure Of Orthorhombic Crystals Of Beef Liver
Catalase
pdb|1TGU|A Chain A, The Crystal Structure Of Bovine Liver Catalase Without
Nadph
pdb|1TGU|B Chain B, The Crystal Structure Of Bovine Liver Catalase Without
Nadph
pdb|1TGU|C Chain C, The Crystal Structure Of Bovine Liver Catalase Without
Nadph
pdb|1TGU|D Chain D, The Crystal Structure Of Bovine Liver Catalase Without
Nadph
pdb|1TH2|A Chain A, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With Azide
pdb|1TH2|B Chain B, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With Azide
pdb|1TH2|C Chain C, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With Azide
pdb|1TH2|D Chain D, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With Azide
pdb|1TH3|A Chain A, Crystal Structure Of Nadph Depleted Bovine Live Catalase
Complexed With Cyanide
pdb|1TH3|B Chain B, Crystal Structure Of Nadph Depleted Bovine Live Catalase
Complexed With Cyanide
pdb|1TH3|C Chain C, Crystal Structure Of Nadph Depleted Bovine Live Catalase
Complexed With Cyanide
pdb|1TH3|D Chain D, Crystal Structure Of Nadph Depleted Bovine Live Catalase
Complexed With Cyanide
pdb|1TH4|A Chain A, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With 3-Amino-1,2,4-Triazole
pdb|1TH4|B Chain B, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With 3-Amino-1,2,4-Triazole
pdb|1TH4|C Chain C, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With 3-Amino-1,2,4-Triazole
pdb|1TH4|D Chain D, Crystal Structure Of Nadph Depleted Bovine Liver Catalase
Complexed With 3-Amino-1,2,4-Triazole
pdb|7CAT|B Chain B, The Nadph Binding Site On Beef Liver Catalase
Length = 506
Score = 28.9 bits (63), Expect = 3.1, Method: Compositional matrix adjust.
Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Query: 6 FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
F L V PH + +P+ L ++ P N+ + ++ L+ P N+P + P P
Sbjct: 296 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 349
Query: 66 LRSRL 70
L+ RL
Sbjct: 350 LQGRL 354
>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver
Catalase Previously Characterized By Electron Microscopy
pdb|3NWL|B Chain B, The Crystal Structure Of The P212121 Form Of Bovine Liver
Catalase Previously Characterized By Electron Microscopy
pdb|3NWL|C Chain C, The Crystal Structure Of The P212121 Form Of Bovine Liver
Catalase Previously Characterized By Electron Microscopy
pdb|3NWL|D Chain D, The Crystal Structure Of The P212121 Form Of Bovine Liver
Catalase Previously Characterized By Electron Microscopy
Length = 527
Score = 28.9 bits (63), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Query: 6 FQLATVKPHHSFSFMPIAPLSISHKPFNFLPKSSTIKCLSNSPKLNLPIKLRPLRHPSLT 65
F L V PH + +P+ L ++ P N+ + ++ L+ P N+P + P P
Sbjct: 297 FDLTKVWPHGDYPLIPVGKLVLNRNPVNYF---AEVEQLAFDPS-NMPPGIEP--SPDKM 350
Query: 66 LRSRL 70
L+ RL
Sbjct: 351 LQGRL 355
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,968,885
Number of Sequences: 62578
Number of extensions: 304686
Number of successful extensions: 698
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 696
Number of HSP's gapped (non-prelim): 5
length of query: 277
length of database: 14,973,337
effective HSP length: 98
effective length of query: 179
effective length of database: 8,840,693
effective search space: 1582484047
effective search space used: 1582484047
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)